BLASTX nr result
ID: Coptis24_contig00015686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00015686 (693 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635069.1| PREDICTED: uncharacterized protein LOC100854... 99 8e-19 ref|XP_002272924.1| PREDICTED: uncharacterized protein LOC100252... 99 1e-18 emb|CAN67529.1| hypothetical protein VITISV_004310 [Vitis vinifera] 99 1e-18 ref|XP_002525796.1| transcription factor, putative [Ricinus comm... 98 1e-18 ref|XP_002262995.1| PREDICTED: uncharacterized protein LOC100264... 98 2e-18 >ref|XP_003635069.1| PREDICTED: uncharacterized protein LOC100854750 [Vitis vinifera] Length = 188 Score = 99.0 bits (245), Expect = 8e-19 Identities = 41/56 (73%), Positives = 50/56 (89%) Frame = +3 Query: 3 DQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVCV 170 DQASLC +CD+K+HSANFLVAKH+R+LLCH+CQ PT W SGPKLGST+S+C+ CV Sbjct: 18 DQASLCCDCDAKVHSANFLVAKHSRTLLCHVCQSPTPWNGSGPKLGSTISVCQRCV 73 >ref|XP_002272924.1| PREDICTED: uncharacterized protein LOC100252747 [Vitis vinifera] Length = 299 Score = 98.6 bits (244), Expect = 1e-18 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = +3 Query: 3 DQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVCV 170 DQASLCW+CD+K+H ANFLVA+H+RSLLCH+C+ PT W ASG KLG TVS+CE CV Sbjct: 18 DQASLCWDCDAKVHGANFLVARHSRSLLCHVCRSPTPWRASGAKLGHTVSVCERCV 73 >emb|CAN67529.1| hypothetical protein VITISV_004310 [Vitis vinifera] Length = 299 Score = 98.6 bits (244), Expect = 1e-18 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = +3 Query: 3 DQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVCV 170 DQASLCW+CD+K+H ANFLVA+H+RSLLCH+C+ PT W ASG KLG TVS+CE CV Sbjct: 18 DQASLCWDCDAKVHGANFLVARHSRSLLCHVCRSPTPWRASGAKLGHTVSVCERCV 73 >ref|XP_002525796.1| transcription factor, putative [Ricinus communis] gi|223534946|gb|EEF36632.1| transcription factor, putative [Ricinus communis] Length = 268 Score = 98.2 bits (243), Expect = 1e-18 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = +3 Query: 3 DQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVC 167 DQASLCW+CD K+HSANFLVAKH R+LLC +CQ PT W ASGPKLG TVS+C+ C Sbjct: 18 DQASLCWSCDEKVHSANFLVAKHCRNLLCQVCQSPTPWKASGPKLGPTVSICDSC 72 >ref|XP_002262995.1| PREDICTED: uncharacterized protein LOC100264749 [Vitis vinifera] Length = 185 Score = 97.8 bits (242), Expect = 2e-18 Identities = 40/56 (71%), Positives = 50/56 (89%) Frame = +3 Query: 3 DQASLCWNCDSKIHSANFLVAKHTRSLLCHLCQFPTSWTASGPKLGSTVSMCEVCV 170 DQASLC +CD+K+HSANFLVAKH+R+LLCH+CQ PT W SGPKLG+T+S+C+ CV Sbjct: 18 DQASLCCDCDAKVHSANFLVAKHSRTLLCHVCQSPTPWNGSGPKLGTTISVCQRCV 73