BLASTX nr result
ID: Coptis24_contig00015685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00015685 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK52316.1| sinapoylglucose:choline sinapoyltransferase [Arab... 78 7e-13 ref|NP_568215.2| sinapoylglucose-choline O-sinapoyltransferase [... 78 7e-13 emb|CAB89366.1| carboxypeptidase-like protein [Arabidopsis thali... 78 7e-13 dbj|BAB09519.1| serine carboxypeptidase [Arabidopsis thaliana] 78 7e-13 ref|NP_850033.1| serine carboxypeptidase-like 12 [Arabidopsis th... 77 1e-12 >gb|AAK52316.1| sinapoylglucose:choline sinapoyltransferase [Arabidopsis thaliana] Length = 464 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -3 Query: 142 VSSGFTVRSLPGFKGPLPFHLETGYVGVGEGGDVQLFYYFVHSERNP 2 V + V+SLPGF+GPLPF LETGYV +GE GDV+LFYYFV SERNP Sbjct: 21 VDASLLVKSLPGFEGPLPFELETGYVSIGESGDVELFYYFVKSERNP 67 >ref|NP_568215.2| sinapoylglucose-choline O-sinapoyltransferase [Arabidopsis thaliana] gi|75161701|sp|Q8VZU3.1|SCP19_ARATH RecName: Full=Serine carboxypeptidase-like 19; AltName: Full=Protein SINAPOYLGLUCOSE ACCUMULATOR 2; AltName: Full=Sinapoylglucose--choline O-sinapoyltransferase; Short=SCT; Contains: RecName: Full=Serine carboxypeptidase-like 19 chain A; Contains: RecName: Full=Serine carboxypeptidase-like 19 chain B; Flags: Precursor gi|17380718|gb|AAL36189.1| putative carboxypeptidase [Arabidopsis thaliana] gi|20259065|gb|AAM14248.1| putative carboxypeptidase [Arabidopsis thaliana] gi|332004037|gb|AED91420.1| sinapoylglucose-choline O-sinapoyltransferase [Arabidopsis thaliana] Length = 465 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -3 Query: 142 VSSGFTVRSLPGFKGPLPFHLETGYVGVGEGGDVQLFYYFVHSERNP 2 V + V+SLPGF+GPLPF LETGYV +GE GDV+LFYYFV SERNP Sbjct: 21 VDASLLVKSLPGFEGPLPFELETGYVSIGESGDVELFYYFVKSERNP 67 >emb|CAB89366.1| carboxypeptidase-like protein [Arabidopsis thaliana] Length = 399 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -3 Query: 142 VSSGFTVRSLPGFKGPLPFHLETGYVGVGEGGDVQLFYYFVHSERNP 2 V + V+SLPGF+GPLPF LETGYV +GE GDV+LFYYFV SERNP Sbjct: 21 VDASLLVKSLPGFEGPLPFELETGYVSIGESGDVELFYYFVKSERNP 67 >dbj|BAB09519.1| serine carboxypeptidase [Arabidopsis thaliana] Length = 443 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -3 Query: 142 VSSGFTVRSLPGFKGPLPFHLETGYVGVGEGGDVQLFYYFVHSERNP 2 V + V+SLPGF+GPLPF LETGYV +GE GDV+LFYYFV SERNP Sbjct: 21 VDASLLVKSLPGFEGPLPFELETGYVSIGESGDVELFYYFVKSERNP 67 >ref|NP_850033.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana] gi|330252280|gb|AEC07374.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana] Length = 408 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -3 Query: 142 VSSGFTVRSLPGFKGPLPFHLETGYVGVGEGGDVQLFYYFVHSERNP 2 V SG V+ LPGF+GPLPF LETGY+G+GE DVQLFYYF+ SERNP Sbjct: 19 VDSGSIVKFLPGFEGPLPFELETGYIGIGEEEDVQLFYYFIKSERNP 65