BLASTX nr result
ID: Coptis24_contig00015247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00015247 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267273.2| PREDICTED: BTB/POZ domain-containing protein... 69 3e-10 ref|XP_002267241.2| PREDICTED: BTB/POZ domain-containing protein... 69 3e-10 ref|XP_003553644.1| PREDICTED: BTB/POZ domain-containing protein... 69 5e-10 ref|XP_003518959.1| PREDICTED: BTB/POZ domain-containing protein... 69 5e-10 gb|ADV56692.1| NPH3 family protein [Phaseolus vulgaris] 69 5e-10 >ref|XP_002267273.2| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 2 [Vitis vinifera] Length = 655 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 251 MGVTTVGELKPSISGKRTFRPSLSTRHATEWPISD 355 MGV TVGELKPSISGKR+FRPS STRHATEWPISD Sbjct: 1 MGVVTVGELKPSISGKRSFRPSSSTRHATEWPISD 35 >ref|XP_002267241.2| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 1 [Vitis vinifera] gi|296086620|emb|CBI32255.3| unnamed protein product [Vitis vinifera] Length = 631 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 251 MGVTTVGELKPSISGKRTFRPSLSTRHATEWPISD 355 MGV TVGELKPSISGKR+FRPS STRHATEWPISD Sbjct: 1 MGVVTVGELKPSISGKRSFRPSSSTRHATEWPISD 35 >ref|XP_003553644.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Glycine max] Length = 651 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +2 Query: 251 MGVTTVGELKPSISGKRTFRPSLSTRHATEWPISD 355 MGV TVGELKPSISGKRTFRPS S RHATEWPISD Sbjct: 24 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISD 58 >ref|XP_003518959.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Glycine max] Length = 630 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +2 Query: 251 MGVTTVGELKPSISGKRTFRPSLSTRHATEWPISD 355 MGV TVGELKPSISGKRTFRPS S RHATEWPISD Sbjct: 1 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISD 35 >gb|ADV56692.1| NPH3 family protein [Phaseolus vulgaris] Length = 731 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +2 Query: 251 MGVTTVGELKPSISGKRTFRPSLSTRHATEWPISD 355 MGV TVGELKPSISGKRTFRPS S RHATEWPISD Sbjct: 105 MGVVTVGELKPSISGKRTFRPSSSIRHATEWPISD 139