BLASTX nr result
ID: Coptis24_contig00013841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00013841 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACX85638.1| putative transposase [Cucumis melo] 55 6e-06 >gb|ACX85638.1| putative transposase [Cucumis melo] Length = 680 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = -1 Query: 132 FSQQACEEAVLRMIIIDGLPFNFVESQGFIDFCNVTCPEFVIP 4 F+Q+ C + + RM+I+D LPF FVES+GF FC P+FVIP Sbjct: 102 FTQENCRKMLARMVILDELPFKFVESEGFHQFCRALNPKFVIP 144