BLASTX nr result
ID: Coptis24_contig00012279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00012279 (482 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1... 88 8e-16 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 86 4e-15 gb|AFK44684.1| unknown [Lotus japonicus] 86 4e-15 ref|XP_002308124.1| predicted protein [Populus trichocarpa] gi|2... 86 4e-15 ref|NP_568593.1| mitochondrial import receptor subunit TOM7-1 [A... 84 1e-14 >ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] gi|223537179|gb|EEF38812.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -3 Query: 345 EEKTMFESFKDWSTWSLKKAKVIVHYGFIPAVIIIGMNSDPKPSLYQLLSPV 190 EEK+ + K+WSTW+LKKAKVI HYGFIP V+IIGMNS+PKP LYQLL+PV Sbjct: 24 EEKSTIQCLKEWSTWTLKKAKVITHYGFIPLVVIIGMNSEPKPQLYQLLTPV 75 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/52 (71%), Positives = 46/52 (88%) Frame = -3 Query: 345 EEKTMFESFKDWSTWSLKKAKVIVHYGFIPAVIIIGMNSDPKPSLYQLLSPV 190 EEK+ ++FK+W+TW++KKAKV+ HYGFIP VIIIGMNS+PKP L QLLSPV Sbjct: 22 EEKSATQAFKEWTTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -3 Query: 345 EEKTMFESFKDWSTWSLKKAKVIVHYGFIPAVIIIGMNSDPKPSLYQLLSPV 190 EEKT E K+W+TW+++KAKV+ HYGFIP +IIIGMNSDPKP L QLLSPV Sbjct: 21 EEKTACECLKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_002308124.1| predicted protein [Populus trichocarpa] gi|222854100|gb|EEE91647.1| predicted protein [Populus trichocarpa] Length = 74 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = -3 Query: 345 EEKTMFESFKDWSTWSLKKAKVIVHYGFIPAVIIIGMNSDPKPSLYQLLSP 193 EEK+ + FK+WSTWS KKAKVI HYGFIP +IIIGMNS+PKP ++QLLSP Sbjct: 23 EEKSASQYFKEWSTWSFKKAKVITHYGFIPMIIIIGMNSEPKPQIHQLLSP 73 >ref|NP_568593.1| mitochondrial import receptor subunit TOM7-1 [Arabidopsis thaliana] gi|26397415|sp|Q9ASY8.1|TOM7A_ARATH RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|13605535|gb|AAK32761.1|AF361593_1 AT5g41690/MBK23_23 [Arabidopsis thaliana] gi|16323286|gb|AAL15398.1| AT5g41690/MBK23_23 [Arabidopsis thaliana] gi|110740409|dbj|BAF02099.1| TOM7 - like protein [Arabidopsis thaliana] gi|332007326|gb|AED94709.1| mitochondrial import receptor subunit TOM7-1 [Arabidopsis thaliana] Length = 75 Score = 84.0 bits (206), Expect = 1e-14 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = -3 Query: 345 EEKTMFESFKDWSTWSLKKAKVIVHYGFIPAVIIIGMNSDPKPSLYQLLSPV 190 ++K+ F+ K+W+ WSLKKAKV+ HYGFIP VI +GMNSDPKP L+QLLSPV Sbjct: 24 DDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPKPHLFQLLSPV 75