BLASTX nr result
ID: Coptis24_contig00011030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00011030 (538 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricin... 102 5e-20 ref|XP_002513939.1| UDP-glucuronosyltransferase, putative [Ricin... 101 8e-20 ref|XP_002513938.1| UDP-glucuronosyltransferase, putative [Ricin... 100 1e-19 ref|XP_003544800.1| PREDICTED: UDP-glycosyltransferase 85A2-like... 100 2e-19 ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like... 100 2e-19 >ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223547023|gb|EEF48520.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 492 Score = 102 bits (253), Expect = 5e-20 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -1 Query: 148 CIPYPAQGHINPMLKLAKLLYQKGFHITFVNTEYNHRRLLKSRGPDSLN 2 C+P+PAQGHINPMLKLAKLL+QKGFHITFVNTEYNH+RLLKSRGPDSLN Sbjct: 24 CVPFPAQGHINPMLKLAKLLHQKGFHITFVNTEYNHQRLLKSRGPDSLN 72 >ref|XP_002513939.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223547025|gb|EEF48522.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 385 Score = 101 bits (251), Expect = 8e-20 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 148 CIPYPAQGHINPMLKLAKLLYQKGFHITFVNTEYNHRRLLKSRGPDSLN 2 CIPYPAQGHINPMLKLAKLL+ KGFHITFVNTEYN+RRLLKSRGPDSLN Sbjct: 14 CIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNYRRLLKSRGPDSLN 62 >ref|XP_002513938.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223547024|gb|EEF48521.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 482 Score = 100 bits (249), Expect = 1e-19 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -1 Query: 148 CIPYPAQGHINPMLKLAKLLYQKGFHITFVNTEYNHRRLLKSRGPDSLN 2 CIPYPAQGHINPMLKLAK LY KGFHITFVN+EYNHRRLLKSRGPDSL+ Sbjct: 14 CIPYPAQGHINPMLKLAKFLYHKGFHITFVNSEYNHRRLLKSRGPDSLD 62 >ref|XP_003544800.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max] Length = 482 Score = 100 bits (248), Expect = 2e-19 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 148 CIPYPAQGHINPMLKLAKLLYQKGFHITFVNTEYNHRRLLKSRGPDSLN 2 CIPYPAQGHINPMLKLAKLL+ KGFHITFVNTEYNH+RLLK+RGPDSLN Sbjct: 14 CIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLN 62 >ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max] Length = 485 Score = 100 bits (248), Expect = 2e-19 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 148 CIPYPAQGHINPMLKLAKLLYQKGFHITFVNTEYNHRRLLKSRGPDSLN 2 CIPYPAQGHINPMLKLAKLL+ KGFHITFVNTEYNH+RLLK+RGPDSLN Sbjct: 15 CIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLN 63