BLASTX nr result
ID: Coptis24_contig00007925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00007925 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525184.1| pentatricopeptide repeat-containing protein,... 159 2e-37 ref|XP_002273172.1| PREDICTED: pentatricopeptide repeat-containi... 159 3e-37 ref|NP_187576.1| pentatricopeptide repeat-containing protein [Ar... 153 1e-35 dbj|BAD95223.1| hypothetical protein [Arabidopsis thaliana] 153 1e-35 ref|XP_004137961.1| PREDICTED: pentatricopeptide repeat-containi... 152 4e-35 >ref|XP_002525184.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535481|gb|EEF37150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 740 Score = 159 bits (403), Expect = 2e-37 Identities = 77/96 (80%), Positives = 83/96 (86%) Frame = +3 Query: 12 ESRLLPKKYMPDSRMYTTLMKGYMKTGRVSDVVRMLEAMRHQSDKASHPDHVTYTTVIST 191 E LLPK Y PDSR+YTTLMKGYM GRVSD +RMLEAMRHQ D ASHPDHV+YTTVIS Sbjct: 365 EPSLLPKVYAPDSRIYTTLMKGYMNQGRVSDTIRMLEAMRHQDDNASHPDHVSYTTVISA 424 Query: 192 LVNVGAMDRARQVLAEMARVGVPANRITYNILLKGY 299 LV G+MDRARQVLAEM R+GVPANRITYNILLKG+ Sbjct: 425 LVKAGSMDRARQVLAEMTRIGVPANRITYNILLKGH 460 >ref|XP_002273172.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Vitis vinifera] Length = 749 Score = 159 bits (401), Expect = 3e-37 Identities = 76/96 (79%), Positives = 82/96 (85%) Frame = +3 Query: 12 ESRLLPKKYMPDSRMYTTLMKGYMKTGRVSDVVRMLEAMRHQSDKASHPDHVTYTTVIST 191 E LLPK Y PDSR+YTTLMKGYMK GRV+D VRMLEAMRHQ D S PDHVTYTTV+S Sbjct: 369 EPPLLPKAYAPDSRIYTTLMKGYMKEGRVTDTVRMLEAMRHQDDSTSQPDHVTYTTVVSA 428 Query: 192 LVNVGAMDRARQVLAEMARVGVPANRITYNILLKGY 299 LV G+MDRARQVLAEM R+GVPANR+TYNILLKGY Sbjct: 429 LVKAGSMDRARQVLAEMTRIGVPANRVTYNILLKGY 464 >ref|NP_187576.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75204290|sp|Q9SF38.1|PP222_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g09650, chloroplastic; AltName: Full=Protein HIGH CHLOROPHYLL FLUORESCENCE 152; Flags: Precursor gi|6682243|gb|AAF23295.1|AC016661_20 hypothetical protein [Arabidopsis thaliana] gi|332641272|gb|AEE74793.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 778 Score = 153 bits (387), Expect = 1e-35 Identities = 74/96 (77%), Positives = 81/96 (84%) Frame = +3 Query: 12 ESRLLPKKYMPDSRMYTTLMKGYMKTGRVSDVVRMLEAMRHQSDKASHPDHVTYTTVIST 191 E LLPK + PDSR+YTTLMKGYMK GRV+D RMLEAMR Q D+ SHPD VTYTTV+S Sbjct: 402 EPPLLPKVFAPDSRIYTTLMKGYMKNGRVADTARMLEAMRRQDDRNSHPDEVTYTTVVSA 461 Query: 192 LVNVGAMDRARQVLAEMARVGVPANRITYNILLKGY 299 VN G MDRARQVLAEMAR+GVPANRITYN+LLKGY Sbjct: 462 FVNAGLMDRARQVLAEMARMGVPANRITYNVLLKGY 497 >dbj|BAD95223.1| hypothetical protein [Arabidopsis thaliana] Length = 778 Score = 153 bits (387), Expect = 1e-35 Identities = 74/96 (77%), Positives = 81/96 (84%) Frame = +3 Query: 12 ESRLLPKKYMPDSRMYTTLMKGYMKTGRVSDVVRMLEAMRHQSDKASHPDHVTYTTVIST 191 E LLPK + PDSR+YTTLMKGYMK GRV+D RMLEAMR Q D+ SHPD VTYTTV+S Sbjct: 402 EPPLLPKVFAPDSRIYTTLMKGYMKNGRVADTARMLEAMRRQDDRNSHPDEVTYTTVVSA 461 Query: 192 LVNVGAMDRARQVLAEMARVGVPANRITYNILLKGY 299 VN G MDRARQVLAEMAR+GVPANRITYN+LLKGY Sbjct: 462 FVNAGLMDRARQVLAEMARMGVPANRITYNVLLKGY 497 >ref|XP_004137961.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Cucumis sativus] gi|449483612|ref|XP_004156638.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Cucumis sativus] Length = 736 Score = 152 bits (383), Expect = 4e-35 Identities = 72/96 (75%), Positives = 82/96 (85%) Frame = +3 Query: 12 ESRLLPKKYMPDSRMYTTLMKGYMKTGRVSDVVRMLEAMRHQSDKASHPDHVTYTTVIST 191 E LLPK Y P+SR+YTTLMKGYM GRV D +RMLEAMR+Q D++SHPDHV+YTTV+S Sbjct: 362 EPPLLPKIYSPNSRIYTTLMKGYMNEGRVGDTIRMLEAMRNQGDRSSHPDHVSYTTVVSA 421 Query: 192 LVNVGAMDRARQVLAEMARVGVPANRITYNILLKGY 299 LV G+MDRARQVLAEM R+G PANRITYNILLKGY Sbjct: 422 LVKAGSMDRARQVLAEMTRIGCPANRITYNILLKGY 457