BLASTX nr result
ID: Coptis24_contig00007532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00007532 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI14958.3| unnamed protein product [Vitis vinifera] 63 2e-08 ref|XP_002511325.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 ref|XP_002277671.2| PREDICTED: C2 and GRAM domain-containing pro... 60 1e-07 >emb|CBI14958.3| unnamed protein product [Vitis vinifera] Length = 1060 Score = 63.2 bits (152), Expect = 2e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = +3 Query: 3 KSTKFQQRITHNITEKFTNRLKELFELVEREILFSFPRDNVT*LLMEIF 149 KST FQQRIT NITEKFT+RLKE+ ELVERE L + P+D +L IF Sbjct: 981 KSTVFQQRITRNITEKFTSRLKEIIELVEREALLNCPQDKFCRILYTIF 1029 >ref|XP_002511325.1| conserved hypothetical protein [Ricinus communis] gi|223550440|gb|EEF51927.1| conserved hypothetical protein [Ricinus communis] Length = 1022 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +3 Query: 3 KSTKFQQRITHNITEKFTNRLKELFELVEREILFSFPRDNV 125 KSTKFQQRIT NITEKFT+R+ E+FEL+ERE+LF+ ++ Sbjct: 981 KSTKFQQRITRNITEKFTHRMNEIFELLEREVLFTIQHGSI 1021 >ref|XP_002277671.2| PREDICTED: C2 and GRAM domain-containing protein At5g50170-like [Vitis vinifera] Length = 1021 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +3 Query: 3 KSTKFQQRITHNITEKFTNRLKELFELVEREILFSFPRDN 122 KST FQQRIT NITEKFT+RLKE+ ELVERE L + P+D+ Sbjct: 980 KSTVFQQRITRNITEKFTSRLKEIIELVEREALLNCPQDS 1019