BLASTX nr result
ID: Coptis24_contig00006222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00006222 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526814.1| peptidase, putative [Ricinus communis] gi|22... 55 8e-06 >ref|XP_002526814.1| peptidase, putative [Ricinus communis] gi|223533818|gb|EEF35549.1| peptidase, putative [Ricinus communis] Length = 129 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 357 QVSQISKEPGVLQVVPSRTYQLHSGPGNLH 268 QV+QISK+PGVLQVVPSRT QLHSGP LH Sbjct: 100 QVAQISKQPGVLQVVPSRTVQLHSGPAKLH 129