BLASTX nr result
ID: Coptis24_contig00005964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00005964 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19832.3| unnamed protein product [Vitis vinifera] 110 1e-22 ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containi... 110 1e-22 ref|XP_002302000.1| predicted protein [Populus trichocarpa] gi|2... 107 1e-21 ref|XP_003590744.1| Pentatricopeptide repeat-containing protein ... 105 5e-21 ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containi... 103 1e-20 >emb|CBI19832.3| unnamed protein product [Vitis vinifera] Length = 544 Score = 110 bits (275), Expect = 1e-22 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +2 Query: 5 PREATIRVLKNLRICGDCHTAFKFMSKVVEREIVVRDGKRFHHFKSGECSCGDYW 169 P AT+RV KNLRICGDCH AFKFMSKVVEREIVVRDGKRFHHFK+GECSCG+YW Sbjct: 490 PLGATVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 544 >ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 110 bits (275), Expect = 1e-22 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +2 Query: 5 PREATIRVLKNLRICGDCHTAFKFMSKVVEREIVVRDGKRFHHFKSGECSCGDYW 169 P AT+RV KNLRICGDCH AFKFMSKVVEREIVVRDGKRFHHFK+GECSCG+YW Sbjct: 745 PLGATVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 799 >ref|XP_002302000.1| predicted protein [Populus trichocarpa] gi|222843726|gb|EEE81273.1| predicted protein [Populus trichocarpa] Length = 797 Score = 107 bits (267), Expect = 1e-21 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 5 PREATIRVLKNLRICGDCHTAFKFMSKVVEREIVVRDGKRFHHFKSGECSCGDYW 169 P AT+RV KNLRICGDCH AFKFMSKVV REIVVRDGKRFHHF+ G+CSCGDYW Sbjct: 743 PHGATVRVFKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 797 >ref|XP_003590744.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479792|gb|AES60995.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 795 Score = 105 bits (261), Expect = 5e-21 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = +2 Query: 5 PREATIRVLKNLRICGDCHTAFKFMSKVVEREIVVRDGKRFHHFKSGECSCGDYW 169 P ATIRV KNLRICGDCH AFK++SKVVEREIVVRD KRFHHFK+GECSCG+YW Sbjct: 741 PLGATIRVFKNLRICGDCHNAFKYISKVVEREIVVRDRKRFHHFKNGECSCGNYW 795 >ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] gi|449504088|ref|XP_004162249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] Length = 797 Score = 103 bits (257), Expect = 1e-20 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +2 Query: 5 PREATIRVLKNLRICGDCHTAFKFMSKVVEREIVVRDGKRFHHFKSGECSCGDYW 169 P+ AT+RV KNLRICGDCH A KFMSKVV REIVVRDGKRFHHFK+GECSC +YW Sbjct: 743 PQGATVRVFKNLRICGDCHNAIKFMSKVVGREIVVRDGKRFHHFKNGECSCRNYW 797