BLASTX nr result
ID: Coptis24_contig00003745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00003745 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF70079.1| isochorismatase hydrolase family protein [Musa ac... 67 2e-09 ref|XP_002530911.1| Isochorismatase, putative [Ricinus communis]... 65 6e-09 ref|XP_002331086.1| predicted protein [Populus trichocarpa] gi|2... 65 7e-09 ref|XP_004143615.1| PREDICTED: isochorismatase-like [Cucumis sat... 64 1e-08 gb|ADR83703.1| nicotinamidase [Nicotiana tabacum] 64 1e-08 >gb|ABF70079.1| isochorismatase hydrolase family protein [Musa acuminata] Length = 197 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 207 STDATATSSMELHEATLKNMAYGFAYLVDCKRLE 106 STDATATS+ +LHEATLKNMAYGFAYLVDCKRLE Sbjct: 157 STDATATSNKDLHEATLKNMAYGFAYLVDCKRLE 190 >ref|XP_002530911.1| Isochorismatase, putative [Ricinus communis] gi|223529505|gb|EEF31460.1| Isochorismatase, putative [Ricinus communis] Length = 202 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 207 STDATATSSMELHEATLKNMAYGFAYLVDCKRLE 106 STDATATS +ELHEATLKN+AYGFAY+VDC+RLE Sbjct: 163 STDATATSDLELHEATLKNLAYGFAYMVDCQRLE 196 >ref|XP_002331086.1| predicted protein [Populus trichocarpa] gi|222872814|gb|EEF09945.1| predicted protein [Populus trichocarpa] Length = 201 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 207 STDATATSSMELHEATLKNMAYGFAYLVDCKRLEE 103 STDATATS +ELHEATLKN+AYGFAYLVDC RL++ Sbjct: 162 STDATATSDLELHEATLKNLAYGFAYLVDCDRLQD 196 >ref|XP_004143615.1| PREDICTED: isochorismatase-like [Cucumis sativus] gi|449516459|ref|XP_004165264.1| PREDICTED: isochorismatase-like [Cucumis sativus] Length = 204 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 207 STDATATSSMELHEATLKNMAYGFAYLVDCKRLEE 103 STDATAT +ELHEATLKN+AYGFAYLVDCKRL E Sbjct: 166 STDATATVDLELHEATLKNLAYGFAYLVDCKRLGE 200 >gb|ADR83703.1| nicotinamidase [Nicotiana tabacum] Length = 162 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 207 STDATATSSMELHEATLKNMAYGFAYLVDCKRLEE 103 STDATATSS ELH+ATLKN+AYGF YLVDCKR+++ Sbjct: 123 STDATATSSAELHDATLKNLAYGFTYLVDCKRIQD 157