BLASTX nr result
ID: Coptis24_contig00003275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00003275 (855 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72135.1| hypothetical protein VITISV_017100 [Vitis vinifera] 101 2e-19 emb|CAN79321.1| hypothetical protein VITISV_018984 [Vitis vinifera] 89 1e-17 emb|CAN64427.1| hypothetical protein VITISV_029384 [Vitis vinifera] 87 5e-17 gb|ABD63193.1| gag-pol polyprotein, putative [Asparagus officina... 91 6e-17 ref|XP_003522113.1| PREDICTED: uncharacterized protein LOC100796... 83 7e-16 >emb|CAN72135.1| hypothetical protein VITISV_017100 [Vitis vinifera] Length = 587 Score = 101 bits (252), Expect = 2e-19 Identities = 44/68 (64%), Positives = 50/68 (73%) Frame = -3 Query: 211 RQNYSAYDLEFYAIF*TLKHWRHYLIHNEFVLHTDHEALKHIGNQDKVSARQLRWSSYLL 32 R Y+ YD EFYAI LKHW HYLIH EF+LHTDHEALKH+ +Q K+S R W SYL Sbjct: 270 RSKYTTYDKEFYAIIQPLKHWEHYLIHQEFILHTDHEALKHLNSQQKLSKRHAHWVSYLQ 329 Query: 31 DFTFVLKH 8 FTFV+KH Sbjct: 330 RFTFVIKH 337 >emb|CAN79321.1| hypothetical protein VITISV_018984 [Vitis vinifera] Length = 1521 Score = 89.0 bits (219), Expect(2) = 1e-17 Identities = 36/68 (52%), Positives = 54/68 (79%) Frame = -3 Query: 211 RQNYSAYDLEFYAIF*TLKHWRHYLIHNEFVLHTDHEALKHIGNQDKVSARQLRWSSYLL 32 ++ YS YDLEFYA+ ++HW+HYL + EFVL++DHEAL+++ +Q K+++R +WSS+L Sbjct: 951 KKKYSTYDLEFYAVVQAIRHWQHYLSYKEFVLYSDHEALRYLNSQKKLNSRHAKWSSFLQ 1010 Query: 31 DFTFVLKH 8 FTF LKH Sbjct: 1011 LFTFNLKH 1018 Score = 27.3 bits (59), Expect(2) = 1e-17 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 251 GRPVAYFSEKLTGSAK 204 G PVA+FSEKL G+ K Sbjct: 937 GHPVAFFSEKLNGAKK 952 >emb|CAN64427.1| hypothetical protein VITISV_029384 [Vitis vinifera] Length = 1392 Score = 86.7 bits (213), Expect(2) = 5e-17 Identities = 35/68 (51%), Positives = 53/68 (77%) Frame = -3 Query: 211 RQNYSAYDLEFYAIF*TLKHWRHYLIHNEFVLHTDHEALKHIGNQDKVSARQLRWSSYLL 32 ++ YS YDLEFYA+ ++HW+HYL + EFVL++DHEAL+++ +Q K+++R +WSS+L Sbjct: 876 KKKYSTYDLEFYAVVQAIRHWQHYLSYKEFVLYSDHEALRYLNSQKKLNSRHAKWSSFLQ 935 Query: 31 DFTFVLKH 8 FTF L H Sbjct: 936 LFTFNLXH 943 Score = 27.3 bits (59), Expect(2) = 5e-17 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 251 GRPVAYFSEKLTGSAK 204 G PVA+FSEKL G+ K Sbjct: 862 GHPVAFFSEKLNGAKK 877 >gb|ABD63193.1| gag-pol polyprotein, putative [Asparagus officinalis] Length = 358 Score = 91.3 bits (225), Expect(2) = 6e-17 Identities = 36/66 (54%), Positives = 53/66 (80%) Frame = -3 Query: 205 NYSAYDLEFYAIF*TLKHWRHYLIHNEFVLHTDHEALKHIGNQDKVSARQLRWSSYLLDF 26 NYS YD EFYA+ +L+HWRHYL+ EFV+++DHEAL+++ +Q K++AR+ RW +L D+ Sbjct: 279 NYSTYDKEFYAVVQSLRHWRHYLLPQEFVIYSDHEALRYLNSQKKLNARRARWVEFLQDY 338 Query: 25 TFVLKH 8 T+ LKH Sbjct: 339 TYTLKH 344 Score = 22.7 bits (47), Expect(2) = 6e-17 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -2 Query: 245 PVAYFSEKLTGS 210 P+AYFS KL+G+ Sbjct: 265 PIAYFSAKLSGA 276 >ref|XP_003522113.1| PREDICTED: uncharacterized protein LOC100796705 [Glycine max] Length = 1010 Score = 83.2 bits (204), Expect(2) = 7e-16 Identities = 35/66 (53%), Positives = 47/66 (71%) Frame = -3 Query: 205 NYSAYDLEFYAIF*TLKHWRHYLIHNEFVLHTDHEALKHIGNQDKVSARQLRWSSYLLDF 26 NYS YD EFYA+ LK W+HYL EFV+H+DHE+LK+I QDK++ R +W +L F Sbjct: 938 NYSTYDKEFYALVQALKTWQHYLYPKEFVIHSDHESLKYIKGQDKLNKRHAKWVEFLEQF 997 Query: 25 TFVLKH 8 +V+KH Sbjct: 998 PYVIKH 1003 Score = 26.9 bits (58), Expect(2) = 7e-16 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 251 GRPVAYFSEKLTG 213 G P+AYFSEKL+G Sbjct: 922 GHPIAYFSEKLSG 934