BLASTX nr result
ID: Coptis24_contig00001043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00001043 (533 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545854.1| PREDICTED: transmembrane protein 184A-like [... 60 3e-07 ref|XP_003543084.1| PREDICTED: transmembrane protein 184A-like [... 60 3e-07 gb|ACU19469.1| unknown [Glycine max] 59 4e-07 emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] 58 8e-07 gb|AAZ32885.1| unknown [Medicago sativa] 57 2e-06 >ref|XP_003545854.1| PREDICTED: transmembrane protein 184A-like [Glycine max] Length = 296 Score = 59.7 bits (143), Expect = 3e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 1 NILVCIEMVIFSIIQRYAYSAAPYSGGVKPKLKSEKKNE 117 NILVC+EMVIFS++Q+YAY APYSG V+ LK KKNE Sbjct: 258 NILVCLEMVIFSVLQQYAYHPAPYSGEVEKMLKQNKKNE 296 >ref|XP_003543084.1| PREDICTED: transmembrane protein 184A-like [Glycine max] Length = 296 Score = 59.7 bits (143), Expect = 3e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 1 NILVCIEMVIFSIIQRYAYSAAPYSGGVKPKLKSEKKNE 117 NILVC+EMVIFS++Q+YAY APYSG V+ LK KKNE Sbjct: 258 NILVCLEMVIFSVLQQYAYHPAPYSGEVEKMLKQNKKNE 296 >gb|ACU19469.1| unknown [Glycine max] Length = 314 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 1 NILVCIEMVIFSIIQRYAYSAAPYSGGVKPKLKSEKKNE 117 NILVC+EMVIFS+ Q+YAY APYSG V+ LK KKNE Sbjct: 258 NILVCLEMVIFSVFQQYAYHPAPYSGEVEKMLKQNKKNE 296 >emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] Length = 295 Score = 58.2 bits (139), Expect = 8e-07 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +1 Query: 1 NILVCIEMVIFSIIQRYAYSAAPYSGGVKPKLKSEKKNE 117 N+LVC+EMV+FS++Q+YAY APYSG ++ KLK KK E Sbjct: 257 NVLVCVEMVVFSVLQQYAYHVAPYSGDMEAKLKLSKKRE 295 >gb|AAZ32885.1| unknown [Medicago sativa] Length = 197 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +1 Query: 1 NILVCIEMVIFSIIQRYAYSAAPYSGGVKPKLK-SEKKNE 117 NILVCIEMV+FS++Q+YAY A+PYSG V+ LK + KKNE Sbjct: 158 NILVCIEMVVFSVLQQYAYHASPYSGEVEKMLKPNNKKNE 197