BLASTX nr result
ID: Coptis23_contig00042871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00042871 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631528.1| PREDICTED: pentatricopeptide repeat-containi... 62 5e-08 ref|XP_002519945.1| pentatricopeptide repeat-containing protein,... 62 5e-08 emb|CAN69066.1| hypothetical protein VITISV_016070 [Vitis vinifera] 62 5e-08 ref|XP_002303270.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002971398.1| hypothetical protein SELMODRAFT_95698 [Selag... 61 8e-08 >ref|XP_003631528.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31790-like [Vitis vinifera] Length = 414 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = +2 Query: 98 NRLLFMYVSCGSLDSARELFDKMTV--KDSISWAIMIAGCVENEEYLEALTLF 250 NR+L MYVSCG + +AR +FDKM V K+SISWAIM+A ++N Y EA+ LF Sbjct: 116 NRILLMYVSCGLIHTARHMFDKMNVLNKNSISWAIMLAAYMDNGFYEEAIFLF 168 >ref|XP_002519945.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540991|gb|EEF42549.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 403 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +2 Query: 98 NRLLFMYVSCGSLDSARELFDKMTV-KDSISWAIMIAGCVENEEYLEALTLFRYKQMGYQ 274 +RLL M+VSCG LD AR LFDKM + KD ISW I+I GC N +Y + LF + + Sbjct: 113 HRLLLMHVSCGQLDIARNLFDKMPLKKDFISWVIVIVGCFSNSKYEAGINLFIDMLLQHS 172 Query: 275 CYE 283 Y+ Sbjct: 173 VYD 175 >emb|CAN69066.1| hypothetical protein VITISV_016070 [Vitis vinifera] Length = 543 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = +2 Query: 98 NRLLFMYVSCGSLDSARELFDKMTV--KDSISWAIMIAGCVENEEYLEALTLF 250 NR+L MYVSCG + +AR +FDKM V K+SISWAIM+A ++N Y EA+ LF Sbjct: 279 NRILLMYVSCGLIHTARHMFDKMNVLNKNSISWAIMLAAYMDNGFYEEAIFLF 331 >ref|XP_002303270.1| predicted protein [Populus trichocarpa] gi|222840702|gb|EEE78249.1| predicted protein [Populus trichocarpa] Length = 805 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = +2 Query: 98 NRLLFMYVSCGSLDSARELFDKMTVKDSISWAIMIAGCVENEEYLEALTLF 250 N L+ MYV CG + SAR LFDKM +D ISW MI+G EN+E LE L LF Sbjct: 174 NALITMYVKCGDVVSARMLFDKMPTRDRISWNAMISGYFENDECLEGLELF 224 >ref|XP_002971398.1| hypothetical protein SELMODRAFT_95698 [Selaginella moellendorffii] gi|300160530|gb|EFJ27147.1| hypothetical protein SELMODRAFT_95698 [Selaginella moellendorffii] Length = 562 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +2 Query: 98 NRLLFMYVSCGSLDSARELFDKMTVKDSISWAIMIAGCVENEEYLEALTLF 250 N LL MYV CGSL+ AR++FD M D+ SW MI C EN E LEAL LF Sbjct: 128 NALLNMYVRCGSLEEARKVFDTMDHPDAFSWTSMITACTENCELLEALELF 178