BLASTX nr result
ID: Coptis23_contig00042562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00042562 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB90588.1| glucosyl transferase [Aquilegia formosa] 57 2e-06 >gb|ABB90588.1| glucosyl transferase [Aquilegia formosa] Length = 151 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +2 Query: 164 AVKMVMDRTSEVGEEVKANHDKWKDFLTSEGLESTFILTISL 289 AVK+VMD SE GEE++ANH KWK+FL SEGLE +++ + L Sbjct: 103 AVKLVMDEGSEFGEEIRANHHKWKEFLLSEGLEFSYLNNLIL 144