BLASTX nr result
ID: Coptis23_contig00040342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040342 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFD33553.1| anthocyanidin reductase, partial [Rosa roxburghii] 60 2e-07 gb|ADP37951.1| anthocyanidin reductase [Fragaria chiloensis] 60 2e-07 gb|ABD95362.1| anthocyanidin reductase [Fragaria x ananassa] 60 2e-07 gb|ABG76843.1| anthocyanidin reductase [Fragaria x ananassa] 60 2e-07 gb|ABG76842.1| anthocyanidin reductase [Fragaria x ananassa] 60 2e-07 >gb|AFD33553.1| anthocyanidin reductase, partial [Rosa roxburghii] Length = 237 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 210 TGNEYMINGFKRMQILSGSISLSHVEDVVRAHIFL 106 TGNE++ING K MQ+LSGSIS++HVEDV RAHIFL Sbjct: 123 TGNEFLINGLKGMQMLSGSISITHVEDVCRAHIFL 157 >gb|ADP37951.1| anthocyanidin reductase [Fragaria chiloensis] Length = 180 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 210 TGNEYMINGFKRMQILSGSISLSHVEDVVRAHIFL 106 TGNE++ING K MQ+LSGSIS++HVEDV RAHIFL Sbjct: 61 TGNEFLINGLKGMQMLSGSISITHVEDVCRAHIFL 95 >gb|ABD95362.1| anthocyanidin reductase [Fragaria x ananassa] Length = 339 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 210 TGNEYMINGFKRMQILSGSISLSHVEDVVRAHIFL 106 TGNE++ING K MQ+LSGSIS++HVEDV RAHIFL Sbjct: 220 TGNEFLINGLKGMQMLSGSISITHVEDVCRAHIFL 254 >gb|ABG76843.1| anthocyanidin reductase [Fragaria x ananassa] Length = 339 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 210 TGNEYMINGFKRMQILSGSISLSHVEDVVRAHIFL 106 TGNE++ING K MQ+LSGSIS++HVEDV RAHIFL Sbjct: 220 TGNEFLINGLKGMQMLSGSISITHVEDVCRAHIFL 254 >gb|ABG76842.1| anthocyanidin reductase [Fragaria x ananassa] Length = 339 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 210 TGNEYMINGFKRMQILSGSISLSHVEDVVRAHIFL 106 TGNE++ING K MQ+LSGSIS++HVEDV RAHIFL Sbjct: 220 TGNEFLINGLKGMQMLSGSISITHVEDVCRAHIFL 254