BLASTX nr result
ID: Coptis23_contig00040276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040276 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26396.3| unnamed protein product [Vitis vinifera] 69 4e-10 ref|XP_002525669.1| pentatricopeptide repeat-containing protein,... 59 4e-07 >emb|CBI26396.3| unnamed protein product [Vitis vinifera] Length = 667 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = -1 Query: 281 KLRSLRDGQKIHAHALLTGFHQHLFVQTALLDMYSKCQCQCQSASRLLFDEMPL 120 KL SL D K+H+H LLTGF H+FVQTAL+D+YSKC C C ++RL+FD+MP+ Sbjct: 40 KLPSLEDATKLHSHILLTGFQAHVFVQTALVDVYSKC-C-CFHSARLVFDQMPI 91 >ref|XP_002525669.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535105|gb|EEF36787.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 494 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = -1 Query: 272 SLRDGQKIHAHALLTGFHQHLFVQTALLDMYSKCQCQCQSASRLLFDEMPL 120 S+RDG KIH+H + GF QH+FV T LLDMYSK C ++SR +FDEMP+ Sbjct: 65 SIRDGTKIHSHLIQLGF-QHVFVMTTLLDMYSK--CYDLASSRKVFDEMPM 112