BLASTX nr result
ID: Coptis23_contig00040213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040213 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588352.1| NADH dehydrogenase subunit [Medicago truncat... 95 2e-20 >ref|XP_003588352.1| NADH dehydrogenase subunit [Medicago truncatula] gi|355477400|gb|AES58603.1| NADH dehydrogenase subunit [Medicago truncatula] Length = 1094 Score = 95.1 bits (235), Expect(2) = 2e-20 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = +2 Query: 128 SMLHESAAFSGVLSHSCPPRSATRSVVLSHKISTPPACWPGESKLSAGQLSTQ 286 +ML+ESAAFS V SHSCPPR ATRSVVLSHKISTPPA WPGESKLS+GQLSTQ Sbjct: 193 AMLNESAAFSVVFSHSCPPRRATRSVVLSHKISTPPASWPGESKLSSGQLSTQ 245 Score = 28.9 bits (63), Expect(2) = 2e-20 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +1 Query: 31 VPLRLRPIFPNRARAGLRA 87 VP R+ PNRARAGLRA Sbjct: 175 VPFRIAANLPNRARAGLRA 193