BLASTX nr result
ID: Coptis23_contig00040151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00040151 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69917.1| hypothetical protein VITISV_044429 [Vitis vinifera] 55 6e-06 >emb|CAN69917.1| hypothetical protein VITISV_044429 [Vitis vinifera] Length = 613 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/49 (44%), Positives = 30/49 (61%) Frame = +3 Query: 102 MSAVQWVCPGSVKLLLASWNVFAHSRKGRRIWSMVPFAILWVLWLERNK 248 + VQWV P SVK +L+SW RK +++W +P I W +W ERNK Sbjct: 519 LCGVQWVFPNSVKEVLSSWKGSFVGRKRKKVWKSIPLFIFWTIWKERNK 567