BLASTX nr result
ID: Coptis23_contig00038268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00038268 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67157.1| hypothetical protein VITISV_039493 [Vitis vinifera] 51 1e-05 >emb|CAN67157.1| hypothetical protein VITISV_039493 [Vitis vinifera] Length = 845 Score = 50.8 bits (120), Expect(2) = 1e-05 Identities = 24/64 (37%), Positives = 37/64 (57%) Frame = -1 Query: 266 HKDWMSAPLNSDEYLDGLESFLKFMTDRLGKGTWCSCPCVRCRNVSGRVDPKIVADHLIR 87 ++DWMS S EY +G+E+F+ F T CPC+RC N+ + P+++ +HL Sbjct: 3 NRDWMSKDRRSIEYDEGVENFINFALAHSTNHTSIKCPCLRCGNLLCQT-PQVIREHLFF 61 Query: 86 IGID 75 GID Sbjct: 62 NGID 65 Score = 23.1 bits (48), Expect(2) = 1e-05 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 72 SYTTWYFHGE 43 SY WY+HGE Sbjct: 67 SYRVWYWHGE 76