BLASTX nr result
ID: Coptis23_contig00036862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036862 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containi... 103 1e-20 emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] 103 1e-20 ref|XP_002512558.1| pentatricopeptide repeat-containing protein,... 97 1e-18 ref|XP_002306265.1| predicted protein [Populus trichocarpa] gi|2... 92 6e-17 sp|Q0WP85.1|PP150_ARATH RecName: Full=Pentatricopeptide repeat-c... 90 2e-16 >ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|296088528|emb|CBI37519.3| unnamed protein product [Vitis vinifera] Length = 525 Score = 103 bits (258), Expect = 1e-20 Identities = 48/66 (72%), Positives = 59/66 (89%) Frame = +2 Query: 116 SSALPTYQPSNDADTISNLLIQHHNPFHTMESSLQLNGITLSSNLVHQSLLRLKHVSKIA 295 S+ LP+ QPS DAD IS +L+QHHNPFH MESSLQLNGI LS++LVHQ+LLRL++VSKIA Sbjct: 41 STGLPSLQPSYDADLISKILLQHHNPFHAMESSLQLNGIALSTHLVHQTLLRLRNVSKIA 100 Query: 296 LAFFVW 313 L+FF+W Sbjct: 101 LSFFLW 106 >emb|CAN60200.1| hypothetical protein VITISV_039678 [Vitis vinifera] Length = 525 Score = 103 bits (258), Expect = 1e-20 Identities = 48/66 (72%), Positives = 59/66 (89%) Frame = +2 Query: 116 SSALPTYQPSNDADTISNLLIQHHNPFHTMESSLQLNGITLSSNLVHQSLLRLKHVSKIA 295 S+ LP+ QPS DAD IS +L+QHHNPFH MESSLQLNGI LS++LVHQ+LLRL++VSKIA Sbjct: 41 STGLPSLQPSYDADLISKILLQHHNPFHAMESSLQLNGIALSTHLVHQTLLRLRNVSKIA 100 Query: 296 LAFFVW 313 L+FF+W Sbjct: 101 LSFFLW 106 >ref|XP_002512558.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548519|gb|EEF50010.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 511 Score = 97.4 bits (241), Expect = 1e-18 Identities = 49/83 (59%), Positives = 66/83 (79%) Frame = +2 Query: 59 SRNLSSLPEELHKHQTNPSSSALPTYQPSNDADTISNLLIQHHNPFHTMESSLQLNGITL 238 +R L + P L + Q S+ +LP+ +PSNDA+ +S +L+ HHNPFH MESSLQL+GITL Sbjct: 9 TRTLLTSPPNL-RVQCLFSTFSLPSLEPSNDAEIVSEILLNHHNPFHAMESSLQLHGITL 67 Query: 239 SSNLVHQSLLRLKHVSKIALAFF 307 SS+L+HQ+LLRL+H SKIAL+FF Sbjct: 68 SSSLLHQTLLRLRHNSKIALSFF 90 >ref|XP_002306265.1| predicted protein [Populus trichocarpa] gi|222855714|gb|EEE93261.1| predicted protein [Populus trichocarpa] Length = 548 Score = 91.7 bits (226), Expect = 6e-17 Identities = 42/65 (64%), Positives = 54/65 (83%) Frame = +2 Query: 113 SSSALPTYQPSNDADTISNLLIQHHNPFHTMESSLQLNGITLSSNLVHQSLLRLKHVSKI 292 + + LPT QPSNDAD +S +L+ HHNPFH MESSLQL GI+L+ +L+HQ+LLRL+H SKI Sbjct: 44 NDTLLPTLQPSNDADLLSQILLHHHNPFHAMESSLQLPGISLTPSLLHQTLLRLRHNSKI 103 Query: 293 ALAFF 307 AL+ F Sbjct: 104 ALSLF 108 >sp|Q0WP85.1|PP150_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g13420, mitochondrial; Flags: Precursor gi|110738270|dbj|BAF01064.1| hypothetical protein [Arabidopsis thaliana] Length = 509 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/61 (68%), Positives = 53/61 (86%) Frame = +2 Query: 125 LPTYQPSNDADTISNLLIQHHNPFHTMESSLQLNGITLSSNLVHQSLLRLKHVSKIALAF 304 LP +PS+DA+ IS +LI +HNPFH MESSLQLNGI+L+ NL+HQ+LLRL+H SKIAL+F Sbjct: 32 LPKLEPSSDAELISQMLITNHNPFHFMESSLQLNGISLTPNLIHQTLLRLRHNSKIALSF 91 Query: 305 F 307 F Sbjct: 92 F 92