BLASTX nr result
ID: Coptis23_contig00036842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036842 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_16442426.1| hypothetical protein HMPREF9544_00145 [Escher... 91 1e-16 ref|ZP_07120344.1| hypothetical protein HMPREF9536_00535 [Escher... 87 1e-15 ref|ZP_07114549.1| hypothetical protein HMPREF9552_00337 [Escher... 87 1e-15 ref|ZP_04532933.1| conserved hypothetical protein [Escherichia s... 87 1e-15 gb|AAX64156.1| hypothetical protein SCH_0250 [Salmonella enteric... 85 5e-15 >ref|ZP_16442426.1| hypothetical protein HMPREF9544_00145 [Escherichia coli MS 153-1] gi|422378484|ref|ZP_16458693.1| hypothetical protein HMPREF9532_00002 [Escherichia coli MS 57-2] gi|315295395|gb|EFU54725.1| hypothetical protein HMPREF9544_00145 [Escherichia coli MS 153-1] gi|324010256|gb|EGB79475.1| hypothetical protein HMPREF9532_00002 [Escherichia coli MS 57-2] Length = 63 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = +3 Query: 3 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDP*RVRENSSRGKFRA 140 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDP VRENSSRGKFRA Sbjct: 18 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDPQGVRENSSRGKFRA 63 >ref|ZP_07120344.1| hypothetical protein HMPREF9536_00535 [Escherichia coli MS 84-1] gi|300405563|gb|EFJ89101.1| hypothetical protein HMPREF9536_00535 [Escherichia coli MS 84-1] Length = 63 Score = 87.4 bits (215), Expect = 1e-15 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = +3 Query: 3 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDP*RVRENSSRGKFRA 140 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQD VRENSSRGKFRA Sbjct: 18 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDSQGVRENSSRGKFRA 63 >ref|ZP_07114549.1| hypothetical protein HMPREF9552_00337 [Escherichia coli MS 198-1] gi|300976091|ref|ZP_07173280.1| hypothetical protein HMPREF9531_01210 [Escherichia coli MS 45-1] gi|301046113|ref|ZP_07193289.1| hypothetical protein HMPREF9549_00253 [Escherichia coli MS 185-1] gi|300301888|gb|EFJ58273.1| hypothetical protein HMPREF9549_00253 [Escherichia coli MS 185-1] gi|300360115|gb|EFJ75985.1| hypothetical protein HMPREF9552_00337 [Escherichia coli MS 198-1] gi|300410144|gb|EFJ93682.1| hypothetical protein HMPREF9531_01210 [Escherichia coli MS 45-1] Length = 63 Score = 87.4 bits (215), Expect = 1e-15 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = +3 Query: 3 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDP*RVRENSSRGKFRA 140 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQD VRENSSRGKFRA Sbjct: 18 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDSQGVRENSSRGKFRA 63 >ref|ZP_04532933.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] gi|226903366|gb|EEH89625.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] Length = 67 Score = 87.4 bits (215), Expect = 1e-15 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = +3 Query: 3 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDP*RVRENSSRGKFRA 140 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQD VRENSSRGKFRA Sbjct: 22 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDSQGVRENSSRGKFRA 67 >gb|AAX64156.1| hypothetical protein SCH_0250 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] Length = 111 Score = 85.1 bits (209), Expect = 5e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 3 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQDP*RVRENSSRGKFRA 140 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQ+ +RENSSRGKFRA Sbjct: 66 PHGSLVPVSSTHRCAYTPGLSTSSSSTFLQETLSLRENSSRGKFRA 111