BLASTX nr result
ID: Coptis23_contig00036804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036804 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529848.1| DNA repair and recombination protein RAD26, ... 55 6e-06 >ref|XP_002529848.1| DNA repair and recombination protein RAD26, putative [Ricinus communis] gi|223530676|gb|EEF32549.1| DNA repair and recombination protein RAD26, putative [Ricinus communis] Length = 1230 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 424 LFKNLLMEIATLEKRPTGKLWVLKPEYQQQ 335 LFKNLL EIATLEK P GK+WVLKPEY+QQ Sbjct: 1201 LFKNLLKEIATLEKDPNGKVWVLKPEYRQQ 1230