BLASTX nr result
ID: Coptis23_contig00036754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036754 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002443435.1| hypothetical protein SORBIDRAFT_08g019436 [S... 88 8e-16 ref|XP_002447931.1| hypothetical protein SORBIDRAFT_06g018328 [S... 87 1e-15 ref|XP_002443644.1| hypothetical protein SORBIDRAFT_08g022750 [S... 86 3e-15 ref|XP_002459817.1| hypothetical protein SORBIDRAFT_02g011180 [S... 86 4e-15 ref|XP_002468682.1| hypothetical protein SORBIDRAFT_01g050160 [S... 86 4e-15 >ref|XP_002443435.1| hypothetical protein SORBIDRAFT_08g019436 [Sorghum bicolor] gi|241944128|gb|EES17273.1| hypothetical protein SORBIDRAFT_08g019436 [Sorghum bicolor] Length = 246 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = +3 Query: 3 FVHSNLRLLSRKSKEYKEGVTTMWDIRGDTFDSLEGVGILEIADLSLDEPEMEAMLF 173 FVH+NLR LSRKS YK G T MWD+ GD+FDSL G+GILE+AD+SLDEPE++AM F Sbjct: 171 FVHTNLRHLSRKSDAYKTGETRMWDVGGDSFDSLGGIGILEVADMSLDEPELQAMTF 227 >ref|XP_002447931.1| hypothetical protein SORBIDRAFT_06g018328 [Sorghum bicolor] gi|241939114|gb|EES12259.1| hypothetical protein SORBIDRAFT_06g018328 [Sorghum bicolor] Length = 219 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = +3 Query: 3 FVHSNLRLLSRKSKEYKEGVTTMWDIRGDTFDSLEGVGILEIADLSLDEPEMEAMLF 173 FVH+NLR LSR+S YK G T MWD+ GD+FDSL G+GILE+ADLSLDEPE++AM F Sbjct: 144 FVHTNLRHLSRRSDAYKTGETRMWDVGGDSFDSLGGIGILEVADLSLDEPELQAMTF 200 >ref|XP_002443644.1| hypothetical protein SORBIDRAFT_08g022750 [Sorghum bicolor] gi|241944337|gb|EES17482.1| hypothetical protein SORBIDRAFT_08g022750 [Sorghum bicolor] Length = 684 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = +3 Query: 3 FVHSNLRLLSRKSKEYKEGVTTMWDIRGDTFDSLEGVGILEIADLSLDEPEMEAMLF 173 FVHSNLR LSR++ YK G T MWD+ GD+FDSL GVGILE+ADLSLDEPE++A+ F Sbjct: 608 FVHSNLRHLSRRTDAYKTGETRMWDVGGDSFDSLGGVGILEVADLSLDEPELQAVSF 664 >ref|XP_002459817.1| hypothetical protein SORBIDRAFT_02g011180 [Sorghum bicolor] gi|241923194|gb|EER96338.1| hypothetical protein SORBIDRAFT_02g011180 [Sorghum bicolor] Length = 647 Score = 85.5 bits (210), Expect = 4e-15 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = +3 Query: 3 FVHSNLRLLSRKSKEYKEGVTTMWDIRGDTFDSLEGVGILEIADLSLDEPEMEAMLF 173 FVH+NLRLLSR+S YK G T MWD+ GD+FDSL G+GILE+A+LS+DEPE++A+ F Sbjct: 573 FVHTNLRLLSRRSDAYKAGETRMWDVGGDSFDSLGGIGILEVANLSVDEPELQAVTF 629 >ref|XP_002468682.1| hypothetical protein SORBIDRAFT_01g050160 [Sorghum bicolor] gi|241922536|gb|EER95680.1| hypothetical protein SORBIDRAFT_01g050160 [Sorghum bicolor] Length = 647 Score = 85.5 bits (210), Expect = 4e-15 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = +3 Query: 3 FVHSNLRLLSRKSKEYKEGVTTMWDIRGDTFDSLEGVGILEIADLSLDEPEMEAMLF 173 FVH+NLRLLSR+S YK G T MWD+ GD+FDSL G+GILE+A+LS+DEPE++A+ F Sbjct: 573 FVHTNLRLLSRRSDAYKAGETRMWDVGGDSFDSLGGIGILEVANLSVDEPELQAVTF 629