BLASTX nr result
ID: Coptis23_contig00036586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036586 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527364.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002527364.1| conserved hypothetical protein [Ricinus communis] gi|223533283|gb|EEF35036.1| conserved hypothetical protein [Ricinus communis] Length = 437 Score = 55.5 bits (132), Expect = 5e-06 Identities = 34/97 (35%), Positives = 47/97 (48%), Gaps = 4/97 (4%) Frame = -2 Query: 332 IPW-IWSKLETGVYKLNTDGAVSELRWGTGGVVRDTNGEVIFGFTGSGGLKSVLF*ELNA 156 I W IW K + G KLNTDG+V G GG++RD G I F L + EL A Sbjct: 269 IRWCIWKKPDVGWIKLNTDGSVDRQHAGFGGLLRDNEGNAICAFVSKAPLDDIFLVELWA 328 Query: 155 RLEG---CRGAQLDNVTVPSNSLSAIRILKEKREHLG 54 G G + + V S+S+SA++ + + H G Sbjct: 329 IWRGLVLALGLGIKVIWVESDSMSAVKTINRVQSHSG 365