BLASTX nr result
ID: Coptis23_contig00036551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00036551 (512 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326092.1| cation proton exchanger [Populus trichocarpa... 55 6e-06 ref|XP_002310518.1| cation proton exchanger [Populus trichocarpa... 55 6e-06 >ref|XP_002326092.1| cation proton exchanger [Populus trichocarpa] gi|222862967|gb|EEF00474.1| cation proton exchanger [Populus trichocarpa] Length = 823 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -2 Query: 358 IHTRGLWLNDHHPLDYALDLLFFQLPIMCITTSILNVLLKPLGHPAIISQILVSKIL 188 I++RGLW +D PL+Y L LL QL ++ I T + + LKPLG P+I+S IL IL Sbjct: 37 INSRGLWFHDD-PLEYTLPLLLLQLSLISIITRSIYIFLKPLGQPSIVSHILGGVIL 92 >ref|XP_002310518.1| cation proton exchanger [Populus trichocarpa] gi|222853421|gb|EEE90968.1| cation proton exchanger [Populus trichocarpa] Length = 769 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/63 (44%), Positives = 39/63 (61%) Frame = -2 Query: 376 CFPTPGIHTRGLWLNDHHPLDYALDLLFFQLPIMCITTSILNVLLKPLGHPAIISQILVS 197 C+ I T G+W D+ PLDY+L L QL ++ +TT +L +LKPL P +IS+IL Sbjct: 1 CYAPTMITTNGIWQGDN-PLDYSLPLFILQLTLVVVTTRLLVYILKPLRQPRVISEILGG 59 Query: 196 KIL 188 IL Sbjct: 60 VIL 62