BLASTX nr result
ID: Coptis23_contig00034457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00034457 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containi... 124 1e-26 ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containi... 112 3e-23 ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containi... 112 3e-23 ref|XP_002513427.1| pentatricopeptide repeat-containing protein,... 108 6e-22 gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucu... 107 1e-21 >ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vitis vinifera] gi|147852271|emb|CAN82234.1| hypothetical protein VITISV_038804 [Vitis vinifera] Length = 567 Score = 124 bits (310), Expect = 1e-26 Identities = 58/88 (65%), Positives = 74/88 (84%) Frame = -2 Query: 266 MAIALLHTMSPLPNPSSTSTKKSCCFFSQIPNLHTPSLNKGFTKILASTHLSIPTKETVF 87 MAI L++ MSP+ +PS + +K C FFSQ+PNLHT SLNKGF+++LAST ++I K+ VF Sbjct: 1 MAI-LVNAMSPITSPSPENARKVCGFFSQVPNLHTLSLNKGFSRVLASTQITISPKDNVF 59 Query: 86 TLPNWRNGKNDNKTKDLRLNDAFLYLEY 3 TLPNWR+GKND +T+DLRLNDAFLYLEY Sbjct: 60 TLPNWRSGKNDPRTRDLRLNDAFLYLEY 87 >ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 112 bits (280), Expect = 3e-23 Identities = 50/84 (59%), Positives = 68/84 (80%) Frame = -2 Query: 254 LLHTMSPLPNPSSTSTKKSCCFFSQIPNLHTPSLNKGFTKILASTHLSIPTKETVFTLPN 75 LL+T+SP+ NPS +T++ C FFS IPN+ SLNKGF+K+LAST ++I K+T+FTLPN Sbjct: 4 LLNTVSPITNPSPETTRRGCGFFSHIPNIQKLSLNKGFSKVLASTQITISPKDTIFTLPN 63 Query: 74 WRNGKNDNKTKDLRLNDAFLYLEY 3 W+ GK D K+K+LRLNDAF +LE+ Sbjct: 64 WKIGKLDQKSKELRLNDAFFHLEF 87 >ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 112 bits (280), Expect = 3e-23 Identities = 50/84 (59%), Positives = 68/84 (80%) Frame = -2 Query: 254 LLHTMSPLPNPSSTSTKKSCCFFSQIPNLHTPSLNKGFTKILASTHLSIPTKETVFTLPN 75 LL+T+SP+ NPS +T++ C FFS IPN+ SLNKGF+K+LAST ++I K+T+FTLPN Sbjct: 4 LLNTVSPITNPSPETTRRGCGFFSHIPNIQKLSLNKGFSKVLASTQITISPKDTIFTLPN 63 Query: 74 WRNGKNDNKTKDLRLNDAFLYLEY 3 W+ GK D K+K+LRLNDAF +LE+ Sbjct: 64 WKIGKLDQKSKELRLNDAFFHLEF 87 >ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547335|gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 108 bits (269), Expect = 6e-22 Identities = 46/85 (54%), Positives = 69/85 (81%) Frame = -2 Query: 257 ALLHTMSPLPNPSSTSTKKSCCFFSQIPNLHTPSLNKGFTKILASTHLSIPTKETVFTLP 78 +L+H++SPL NP + + + +C FFS IPNLH+ SLNK FT++LAST ++I K++V TLP Sbjct: 3 SLVHSVSPLTNPFTEAARIACGFFSHIPNLHSFSLNKDFTRVLASTQITISPKDSVITLP 62 Query: 77 NWRNGKNDNKTKDLRLNDAFLYLEY 3 NWR+GKND + +D+R++DAF +LE+ Sbjct: 63 NWRSGKNDQRNRDMRISDAFFHLEH 87 >gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucumis melo subsp. melo] Length = 566 Score = 107 bits (267), Expect = 1e-21 Identities = 48/84 (57%), Positives = 66/84 (78%) Frame = -2 Query: 254 LLHTMSPLPNPSSTSTKKSCCFFSQIPNLHTPSLNKGFTKILASTHLSIPTKETVFTLPN 75 LL+T+SP+ N S +T++ C FFS IPNL SLNKGF+K+LAST ++I K+T+FTLPN Sbjct: 4 LLNTVSPITNTSPETTRRGCGFFSHIPNLQKLSLNKGFSKVLASTQITISPKDTIFTLPN 63 Query: 74 WRNGKNDNKTKDLRLNDAFLYLEY 3 W+ GK + K+K+LRL DAF +LE+ Sbjct: 64 WKTGKVEQKSKELRLTDAFFHLEF 87