BLASTX nr result
ID: Coptis23_contig00031905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00031905 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516766.1| PREDICTED: 40S ribosomal protein S20-1-like ... 56 3e-06 ref|XP_002302530.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002302399.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_001416866.1| Ribosomal protein S20, component of cytosoli... 56 3e-06 ref|XP_003078013.1| ribosomal protein S20 (ISS) [Ostreococcus ta... 56 3e-06 >ref|XP_003516766.1| PREDICTED: 40S ribosomal protein S20-1-like [Glycine max] Length = 135 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 35 SRKCVLILCLSGAKTRTLKVRGPVRIPTKVLKITARNSPCGEG 163 SRK + + GAK + L+V+GPVR+PTKVL IT R SPCGEG Sbjct: 47 SRKALCADLVRGAKDKRLRVKGPVRMPTKVLNITTRKSPCGEG 89 >ref|XP_002302530.1| predicted protein [Populus trichocarpa] gi|222844256|gb|EEE81803.1| predicted protein [Populus trichocarpa] Length = 121 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +2 Query: 62 LSGAKTRTLKVRGPVRIPTKVLKITARNSPCGEG 163 + GAK ++LKV+GPVRIPTKVL+IT R +PCGEG Sbjct: 43 IRGAKDKSLKVKGPVRIPTKVLRITTRKAPCGEG 76 >ref|XP_002302399.1| predicted protein [Populus trichocarpa] gi|222844125|gb|EEE81672.1| predicted protein [Populus trichocarpa] Length = 75 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +2 Query: 44 CVLILCLSGAKTRTLKVRGPVRIPTKVLKITARNSPCGEG 163 C ++C GAK ++LK++GPVRIPTKVL+IT R +PCGEG Sbjct: 2 CADLIC--GAKDKSLKMKGPVRIPTKVLQITTRKAPCGEG 39 >ref|XP_001416866.1| Ribosomal protein S20, component of cytosolic 80S ribosome and 40S small subunit [Ostreococcus lucimarinus CCE9901] gi|144577092|gb|ABO95159.1| Ribosomal protein S20, component of cytosolic 80S ribosome and 40S small subunit [Ostreococcus lucimarinus CCE9901] Length = 125 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 62 LSGAKTRTLKVRGPVRIPTKVLKITARNSPCGEG 163 + GAK + LKV+GPVR+PTKVLK+T R SPCGEG Sbjct: 46 IRGAKDKRLKVKGPVRMPTKVLKLTVRKSPCGEG 79 >ref|XP_003078013.1| ribosomal protein S20 (ISS) [Ostreococcus tauri] gi|116056464|emb|CAL52753.1| ribosomal protein S20 (ISS) [Ostreococcus tauri] Length = 380 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 62 LSGAKTRTLKVRGPVRIPTKVLKITARNSPCGEG 163 + GAK + LKV+GPVR+PTKVLK+T R SPCGEG Sbjct: 302 IRGAKDKRLKVKGPVRMPTKVLKLTVRKSPCGEG 335