BLASTX nr result
ID: Coptis23_contig00031800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00031800 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529363.1| PREDICTED: dolichol-phosphate mannosyltransf... 82 3e-14 ref|XP_002300644.1| predicted protein [Populus trichocarpa] gi|2... 82 3e-14 ref|XP_002510671.1| dolichol-phosphate mannosyltransferase, puta... 82 4e-14 ref|XP_004145537.1| PREDICTED: dolichol-phosphate mannosyltransf... 79 3e-13 ref|XP_002307788.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 >ref|XP_003529363.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Glycine max] Length = 243 Score = 82.4 bits (202), Expect = 3e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +2 Query: 2 GYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 121 GYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT Sbjct: 204 GYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 243 >ref|XP_002300644.1| predicted protein [Populus trichocarpa] gi|222842370|gb|EEE79917.1| predicted protein [Populus trichocarpa] Length = 240 Score = 82.4 bits (202), Expect = 3e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +2 Query: 2 GYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 121 GYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT Sbjct: 201 GYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 240 >ref|XP_002510671.1| dolichol-phosphate mannosyltransferase, putative [Ricinus communis] gi|223551372|gb|EEF52858.1| dolichol-phosphate mannosyltransferase, putative [Ricinus communis] Length = 238 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +2 Query: 2 GYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 121 GYHIEEVPITF+DRVFGSSKLGGSEIVEYLKGLAYLLVTT Sbjct: 199 GYHIEEVPITFIDRVFGSSKLGGSEIVEYLKGLAYLLVTT 238 >ref|XP_004145537.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cucumis sativus] gi|449512678|ref|XP_004164113.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cucumis sativus] Length = 242 Score = 79.3 bits (194), Expect = 3e-13 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 GYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 121 GYHIEEVPITFVDRVFG+SKLGGSEIVEYLKGL YLLVTT Sbjct: 203 GYHIEEVPITFVDRVFGTSKLGGSEIVEYLKGLLYLLVTT 242 >ref|XP_002307788.1| predicted protein [Populus trichocarpa] gi|222857237|gb|EEE94784.1| predicted protein [Populus trichocarpa] Length = 238 Score = 79.3 bits (194), Expect = 3e-13 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +2 Query: 2 GYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 121 GY IEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT Sbjct: 199 GYQIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 238