BLASTX nr result
ID: Coptis23_contig00031796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00031796 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002866723.1| transcriptional factor B3 family protein [Ar... 60 1e-07 ref|XP_004147830.1| PREDICTED: B3 domain-containing protein Os01... 56 3e-06 ref|XP_002269004.1| PREDICTED: putative B3 domain-containing pro... 55 8e-06 emb|CAN76392.1| hypothetical protein VITISV_011465 [Vitis vinifera] 55 8e-06 >ref|XP_002866723.1| transcriptional factor B3 family protein [Arabidopsis lyrata subsp. lyrata] gi|297312558|gb|EFH42982.1| transcriptional factor B3 family protein [Arabidopsis lyrata subsp. lyrata] Length = 332 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/69 (39%), Positives = 38/69 (55%) Frame = -3 Query: 210 WRTFVQDHAVEFGDFIVFRYNGISELGVKIFGKDGCEKQVRLAKMKKTESESYSDKGRIN 31 W +F D ++EFGDF+VFRY+G S V IF KDGC+K + + S +K ++ Sbjct: 74 WESFANDQSLEFGDFLVFRYDGDSRFSVTIFAKDGCKKDIGVVTTTDRSRVSVDEKEPVD 133 Query: 30 SKETASLRK 4 LRK Sbjct: 134 ISTEPELRK 142 >ref|XP_004147830.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Cucumis sativus] Length = 580 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/47 (46%), Positives = 31/47 (65%) Frame = -3 Query: 234 NGLVLCDEWRTFVQDHAVEFGDFIVFRYNGISELGVKIFGKDGCEKQ 94 + L CD W TF +DHA+E GDF+VFRY+ V++F + CEK+ Sbjct: 68 DNLFFCDGWPTFARDHALECGDFLVFRYDSELNFNVQVFDQSACEKE 114 >ref|XP_002269004.1| PREDICTED: putative B3 domain-containing protein Os03g0621600-like [Vitis vinifera] Length = 390 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/62 (43%), Positives = 37/62 (59%) Frame = -3 Query: 210 WRTFVQDHAVEFGDFIVFRYNGISELGVKIFGKDGCEKQVRLAKMKKTESESYSDKGRIN 31 W FVQD+ +E GDF+VF Y G S+ V I+GK CEK++ A E S D+ + N Sbjct: 74 WGKFVQDNFLELGDFLVFHYVGNSKFEVIIYGKHCCEKELLAATASNDEPHSKGDERQEN 133 Query: 30 SK 25 +K Sbjct: 134 AK 135 >emb|CAN76392.1| hypothetical protein VITISV_011465 [Vitis vinifera] Length = 765 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/62 (43%), Positives = 37/62 (59%) Frame = -3 Query: 210 WRTFVQDHAVEFGDFIVFRYNGISELGVKIFGKDGCEKQVRLAKMKKTESESYSDKGRIN 31 W FVQD+ +E GDF+VF Y G S+ V I+GK CEK++ A E S D+ + N Sbjct: 137 WGKFVQDNFLELGDFLVFHYVGNSKFEVIIYGKHCCEKELLAATASNDEPHSKGDERQEN 196 Query: 30 SK 25 +K Sbjct: 197 AK 198