BLASTX nr result
ID: Coptis23_contig00031653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00031653 (655 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309825.1| predicted protein [Populus trichocarpa] gi|2... 63 6e-08 ref|XP_003521614.1| PREDICTED: pto-interacting protein 1-like [G... 62 7e-08 ref|XP_003591323.1| Pto kinase interactor [Medicago truncatula] ... 62 7e-08 ref|XP_003591322.1| Pto kinase interactor [Medicago truncatula] ... 62 7e-08 ref|NP_001237620.1| serine/threonine protein kinase [Glycine max... 62 7e-08 >ref|XP_002309825.1| predicted protein [Populus trichocarpa] gi|222852728|gb|EEE90275.1| predicted protein [Populus trichocarpa] Length = 368 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 560 VSMASRLKHDNFVQLLGYCVEGNIRVLAYEFA 655 VSM SRLKH+NFV+LLGYCVEGN+RVLAYEFA Sbjct: 117 VSMVSRLKHENFVELLGYCVEGNLRVLAYEFA 148 >ref|XP_003521614.1| PREDICTED: pto-interacting protein 1-like [Glycine max] Length = 361 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 560 VSMASRLKHDNFVQLLGYCVEGNIRVLAYEFA 655 VSM SRLKHDNFVQLLGYC++GN RVLAYEFA Sbjct: 113 VSMVSRLKHDNFVQLLGYCIDGNSRVLAYEFA 144 >ref|XP_003591323.1| Pto kinase interactor [Medicago truncatula] gi|355480371|gb|AES61574.1| Pto kinase interactor [Medicago truncatula] Length = 271 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 560 VSMASRLKHDNFVQLLGYCVEGNIRVLAYEFA 655 VSM SRLKHDNFVQLLGYCV+GN R+LAYEFA Sbjct: 228 VSMVSRLKHDNFVQLLGYCVDGNSRILAYEFA 259 >ref|XP_003591322.1| Pto kinase interactor [Medicago truncatula] gi|355480370|gb|AES61573.1| Pto kinase interactor [Medicago truncatula] Length = 476 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 560 VSMASRLKHDNFVQLLGYCVEGNIRVLAYEFA 655 VSM SRLKHDNFVQLLGYCV+GN R+LAYEFA Sbjct: 228 VSMVSRLKHDNFVQLLGYCVDGNSRILAYEFA 259 >ref|NP_001237620.1| serine/threonine protein kinase [Glycine max] gi|223452365|gb|ACM89510.1| serine/threonine protein kinase [Glycine max] Length = 361 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 560 VSMASRLKHDNFVQLLGYCVEGNIRVLAYEFA 655 VSM SRLKHDNFVQLLGYC++GN RVLAYEFA Sbjct: 113 VSMVSRLKHDNFVQLLGYCIDGNSRVLAYEFA 144