BLASTX nr result
ID: Coptis23_contig00031652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00031652 (489 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74932.1| hypothetical protein VITISV_044432 [Vitis vinifera] 57 2e-06 >emb|CAN74932.1| hypothetical protein VITISV_044432 [Vitis vinifera] Length = 486 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/58 (55%), Positives = 38/58 (65%), Gaps = 3/58 (5%) Frame = -2 Query: 416 RWDNEAERSRVLAEKHKRGAAARELRATKKA---YSSNNGSKRRMPSHNTGQSPKRHR 252 RW NEAER +VLAEKHKRGAAAR +R+ KKA SSN G + H+T + R R Sbjct: 256 RWKNEAERLQVLAEKHKRGAAARLVRSKKKAKKKLSSNGGEGYQKHFHHTKPAQVRRR 313