BLASTX nr result
ID: Coptis23_contig00028056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028056 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX07458.2| ethylene-responsive element binding protein ERF2 ... 60 2e-07 ref|XP_004166643.1| PREDICTED: ethylene-responsive transcription... 59 5e-07 ref|XP_004144443.1| PREDICTED: ethylene-responsive transcription... 59 5e-07 gb|AEK81532.1| ethylene response factor [Ophiopogon japonicus] 59 5e-07 gb|AAL67489.1|AF459404_1 AP-2 domain containing protein [Narciss... 57 2e-06 >gb|AAX07458.2| ethylene-responsive element binding protein ERF2 [Gossypium hirsutum] Length = 390 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 141 MCGGAIISDFIPPTRSRRVTADLLWPHLKK 230 MCGGAIISDFIPP+RSRR+TAD LWP LKK Sbjct: 1 MCGGAIISDFIPPSRSRRLTADFLWPDLKK 30 >ref|XP_004166643.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Cucumis sativus] Length = 370 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 141 MCGGAIISDFIPPTRSRRVTADLLWPHLKK 230 MCGGAIISDFIPP+RS RVTAD LWP+LKK Sbjct: 1 MCGGAIISDFIPPSRSNRVTADHLWPNLKK 30 >ref|XP_004144443.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Cucumis sativus] Length = 370 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 141 MCGGAIISDFIPPTRSRRVTADLLWPHLKK 230 MCGGAIISDFIPP+RS RVTAD LWP+LKK Sbjct: 1 MCGGAIISDFIPPSRSNRVTADHLWPNLKK 30 >gb|AEK81532.1| ethylene response factor [Ophiopogon japonicus] Length = 348 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 141 MCGGAIISDFIPPTRSRRVTADLLWPHLKK 230 MCGGAIISDFIPP RSR++TAD LWP+LKK Sbjct: 1 MCGGAIISDFIPPARSRKLTADYLWPNLKK 30 >gb|AAL67489.1|AF459404_1 AP-2 domain containing protein [Narcissus pseudonarcissus] Length = 153 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 141 MCGGAIISDFIPPTRSRRVTADLLWPHLKK 230 MCGGAIISDFIPP+RSR++TAD LWP+L K Sbjct: 1 MCGGAIISDFIPPSRSRKLTADYLWPNLNK 30