BLASTX nr result
ID: Coptis23_contig00025135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025135 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK48226.1| unknown [Lotus japonicus] 64 1e-08 ref|XP_003602152.1| Protein MKS1 [Medicago truncatula] gi|355491... 64 2e-08 ref|XP_002526136.1| Protein MKS1, putative [Ricinus communis] gi... 64 2e-08 ref|XP_003634495.1| PREDICTED: protein MKS1-like [Vitis vinifera] 61 1e-07 ref|XP_002302188.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 >gb|AFK48226.1| unknown [Lotus japonicus] Length = 238 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/40 (75%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = +1 Query: 166 ETPYDKP---SPRRELQGPRPTPLKVRKDSHKIKKPPIAP 276 E P D P SPRRELQGPRPTPL++ KDSHKIKKPP+AP Sbjct: 2 EFPADIPMGRSPRRELQGPRPTPLRINKDSHKIKKPPLAP 41 >ref|XP_003602152.1| Protein MKS1 [Medicago truncatula] gi|355491200|gb|AES72403.1| Protein MKS1 [Medicago truncatula] Length = 248 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 160 WPETPYDKPSPRRELQGPRPTPLKVRKDSHKIKKPPIAP 276 +P+ P + SPRRELQGPRPTPL++ KDSHKIKKPP+AP Sbjct: 4 FPDIPTGR-SPRRELQGPRPTPLRIHKDSHKIKKPPLAP 41 >ref|XP_002526136.1| Protein MKS1, putative [Ricinus communis] gi|223534513|gb|EEF36212.1| Protein MKS1, putative [Ricinus communis] Length = 254 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/38 (78%), Positives = 32/38 (84%), Gaps = 3/38 (7%) Frame = +1 Query: 172 PYDKP---SPRRELQGPRPTPLKVRKDSHKIKKPPIAP 276 PYD P SPR+ELQGPRP LKVRKDSHKIKKPP+AP Sbjct: 3 PYDFPVTRSPRKELQGPRPPALKVRKDSHKIKKPPVAP 40 >ref|XP_003634495.1| PREDICTED: protein MKS1-like [Vitis vinifera] Length = 218 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 187 SPRRELQGPRPTPLKVRKDSHKIKKPPIAP 276 SPRREL GPRPTPLKVRKDSHKI+KPP+ P Sbjct: 11 SPRRELLGPRPTPLKVRKDSHKIRKPPVVP 40 >ref|XP_002302188.1| predicted protein [Populus trichocarpa] gi|222843914|gb|EEE81461.1| predicted protein [Populus trichocarpa] Length = 263 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +1 Query: 142 TDLKMDWPETPYDKPSPRRELQGPRPTPLKVRKDSHKIKKPPIAP 276 T MD + P + SPR+ELQGPRP LK+RKDSHKI+KPP+AP Sbjct: 28 TGFSMDSSDFPISR-SPRKELQGPRPPALKIRKDSHKIRKPPVAP 71