BLASTX nr result
ID: Coptis23_contig00024404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00024404 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633438.1| PREDICTED: phosphoinositide phospholipase C ... 68 7e-10 ref|XP_002270230.1| PREDICTED: phosphoinositide phospholipase C ... 68 7e-10 ref|XP_004166852.1| PREDICTED: phosphoinositide phospholipase C ... 63 2e-08 ref|XP_004138421.1| PREDICTED: phosphoinositide phospholipase C ... 63 2e-08 ref|XP_002533649.1| 1-phosphatidylinositol-4,5-bisphosphate phos... 63 3e-08 >ref|XP_003633438.1| PREDICTED: phosphoinositide phospholipase C 2 [Vitis vinifera] Length = 563 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 5/48 (10%) Frame = -2 Query: 131 NLDSFRSYVFF-----FSCFQVHHDMSAPVSHYFIYTGHNSYLTGNHL 3 NL++F Y+F S FQVHHDM+AP+SHYF+YTGHNSYLTGN L Sbjct: 85 NLEAFFKYLFGDINPPLSLFQVHHDMTAPLSHYFVYTGHNSYLTGNQL 132 >ref|XP_002270230.1| PREDICTED: phosphoinositide phospholipase C 2 isoform 2 [Vitis vinifera] Length = 592 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 5/48 (10%) Frame = -2 Query: 131 NLDSFRSYVFF-----FSCFQVHHDMSAPVSHYFIYTGHNSYLTGNHL 3 NL++F Y+F S FQVHHDM+AP+SHYF+YTGHNSYLTGN L Sbjct: 85 NLEAFFKYLFGDINPPLSLFQVHHDMTAPLSHYFVYTGHNSYLTGNQL 132 >ref|XP_004166852.1| PREDICTED: phosphoinositide phospholipase C 6-like, partial [Cucumis sativus] Length = 488 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/47 (65%), Positives = 33/47 (70%), Gaps = 5/47 (10%) Frame = -2 Query: 128 LDSFRSYVFFFSC-----FQVHHDMSAPVSHYFIYTGHNSYLTGNHL 3 LD F Y+F QVHHDMSAP+SHYFIYTGHNSYLTGN L Sbjct: 92 LDDFFHYLFMDDFNGPIKTQVHHDMSAPLSHYFIYTGHNSYLTGNQL 138 >ref|XP_004138421.1| PREDICTED: phosphoinositide phospholipase C 6-like [Cucumis sativus] Length = 586 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/47 (65%), Positives = 33/47 (70%), Gaps = 5/47 (10%) Frame = -2 Query: 128 LDSFRSYVFFFSC-----FQVHHDMSAPVSHYFIYTGHNSYLTGNHL 3 LD F Y+F QVHHDMSAP+SHYFIYTGHNSYLTGN L Sbjct: 92 LDDFFHYLFMDDFNGPIKTQVHHDMSAPLSHYFIYTGHNSYLTGNQL 138 >ref|XP_002533649.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative [Ricinus communis] gi|223526462|gb|EEF28737.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative [Ricinus communis] Length = 601 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/48 (62%), Positives = 34/48 (70%), Gaps = 5/48 (10%) Frame = -2 Query: 131 NLDSFRSYVFFFSCF-----QVHHDMSAPVSHYFIYTGHNSYLTGNHL 3 NLD F ++ F QVHHDM+AP+SHYFIYTGHNSYLTGN L Sbjct: 108 NLDDFFHFLLFDDINGPIIPQVHHDMTAPLSHYFIYTGHNSYLTGNQL 155