BLASTX nr result
ID: Coptis23_contig00016410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016410 (195 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515072.1| pentatricopeptide repeat-containing protein,... 82 5e-14 ref|XP_002301440.1| predicted protein [Populus trichocarpa] gi|2... 82 5e-14 ref|XP_002268415.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 emb|CBI38708.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_003534128.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 >ref|XP_002515072.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545552|gb|EEF47056.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 504 Score = 82.0 bits (201), Expect = 5e-14 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -3 Query: 142 EMNNMCCYPDRDTYKVLMRALCQDKRLNEATHVLYSMFWRISQKGSG 2 EMN CYPDRD+Y+++M LC+D RLNEATH+LYSMFWRISQKGSG Sbjct: 176 EMNYQGCYPDRDSYRIVMMGLCKDGRLNEATHLLYSMFWRISQKGSG 222 >ref|XP_002301440.1| predicted protein [Populus trichocarpa] gi|222843166|gb|EEE80713.1| predicted protein [Populus trichocarpa] Length = 503 Score = 82.0 bits (201), Expect = 5e-14 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -3 Query: 142 EMNNMCCYPDRDTYKVLMRALCQDKRLNEATHVLYSMFWRISQKGSG 2 EM+ CYP+RD+Y++LMR LC+D RLNEATH+LYSMFWRISQKGSG Sbjct: 176 EMDYQGCYPNRDSYRILMRGLCEDGRLNEATHLLYSMFWRISQKGSG 222 >ref|XP_002268415.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Vitis vinifera] Length = 503 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 157 LYGLGEMNNMCCYPDRDTYKVLMRALCQDKRLNEATHVLYSMFWRISQKGSG 2 L+ EM CC PD+++Y++LMR LC+D RLNEATH+LYSMFWRISQKG G Sbjct: 171 LHVFQEMRYQCCSPDKESYRILMRGLCEDGRLNEATHLLYSMFWRISQKGGG 222 >emb|CBI38708.3| unnamed protein product [Vitis vinifera] Length = 466 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 157 LYGLGEMNNMCCYPDRDTYKVLMRALCQDKRLNEATHVLYSMFWRISQKGSG 2 L+ EM CC PD+++Y++LMR LC+D RLNEATH+LYSMFWRISQKG G Sbjct: 171 LHVFQEMRYQCCSPDKESYRILMRGLCEDGRLNEATHLLYSMFWRISQKGGG 222 >ref|XP_003534128.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Glycine max] Length = 502 Score = 80.1 bits (196), Expect = 2e-13 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -3 Query: 142 EMNNMCCYPDRDTYKVLMRALCQDKRLNEATHVLYSMFWRISQKGSG 2 EM+ CYP+RD+Y +LM+ LCQD+RL+EATH+LYSMFWRISQKG+G Sbjct: 176 EMDYQSCYPNRDSYAILMKGLCQDRRLHEATHLLYSMFWRISQKGNG 222