BLASTX nr result
ID: Coptis23_contig00016377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016377 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282050.1| PREDICTED: protein RER1B [Vitis vinifera] gi... 72 6e-11 ref|XP_004152693.1| PREDICTED: protein RER1B-like [Cucumis sativ... 67 2e-09 ref|XP_002510410.1| rer1 protein, putative [Ricinus communis] gi... 65 6e-09 ref|NP_001235708.1| uncharacterized protein LOC100499765 [Glycin... 65 7e-09 ref|NP_001236815.1| uncharacterized protein LOC100305541 [Glycin... 65 7e-09 >ref|XP_002282050.1| PREDICTED: protein RER1B [Vitis vinifera] gi|302142515|emb|CBI19718.3| unnamed protein product [Vitis vinifera] Length = 194 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 383 LTMKRQILHMIKYKYIPFNIGKRKYTGKKSAASGIGSPRD 264 LTMKRQI+HMIKYKY+PF+IGK++YTGKKSAAS G PRD Sbjct: 155 LTMKRQIMHMIKYKYVPFSIGKQRYTGKKSAASSRGLPRD 194 >ref|XP_004152693.1| PREDICTED: protein RER1B-like [Cucumis sativus] gi|449496096|ref|XP_004160038.1| PREDICTED: protein RER1B-like [Cucumis sativus] Length = 194 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -2 Query: 383 LTMKRQILHMIKYKYIPFNIGKRKYTGKKSAASGIGSPRD 264 LTMKRQI+HMIKYKYIPF+IGK++YTGK+S+AS G RD Sbjct: 155 LTMKRQIMHMIKYKYIPFSIGKQRYTGKRSSASSSGVSRD 194 >ref|XP_002510410.1| rer1 protein, putative [Ricinus communis] gi|223551111|gb|EEF52597.1| rer1 protein, putative [Ricinus communis] Length = 194 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 383 LTMKRQILHMIKYKYIPFNIGKRKYTGKKSAASGIGSPRD 264 LTMKRQI+HMIKYKY+PF++GK++Y+GKKSAAS G +D Sbjct: 155 LTMKRQIMHMIKYKYVPFSVGKQRYSGKKSAASSSGILKD 194 >ref|NP_001235708.1| uncharacterized protein LOC100499765 [Glycine max] gi|255626409|gb|ACU13549.1| unknown [Glycine max] Length = 196 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 383 LTMKRQILHMIKYKYIPFNIGKRKYTGKKSAASGIGSPRD 264 LTM+RQ+ HM+KYKYIPFN+GK+KY+GKKS+AS GS D Sbjct: 157 LTMRRQVAHMMKYKYIPFNLGKQKYSGKKSSASSSGSRAD 196 >ref|NP_001236815.1| uncharacterized protein LOC100305541 [Glycine max] gi|255625857|gb|ACU13273.1| unknown [Glycine max] Length = 194 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 383 LTMKRQILHMIKYKYIPFNIGKRKYTGKKSAASGIGSPRD 264 LTM+RQ+ HM+KYKYIPFN+GK+KY+GKKS+AS GS D Sbjct: 155 LTMRRQVAHMMKYKYIPFNLGKQKYSGKKSSASSSGSRAD 194