BLASTX nr result
ID: Coptis23_contig00016250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016250 (1230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16151.3| unnamed protein product [Vitis vinifera] 60 1e-06 ref|XP_002281137.1| PREDICTED: probable S-acyltransferase At2g14... 60 1e-06 >emb|CBI16151.3| unnamed protein product [Vitis vinifera] Length = 311 Score = 59.7 bits (143), Expect = 1e-06 Identities = 33/69 (47%), Positives = 43/69 (62%) Frame = +2 Query: 899 RSFSLLNYFLFLPLKFNVVLNYFAALVLLVFSGVAKFFRRLLRLHASAPAFVFFNTLFIW 1078 R F+ + + LPL +AL+LLV G + RR L ++ASAPAFVFFN LFIW Sbjct: 39 RFFAASSLLIQLPL---------SALLLLVLLGAGRCCRRFLGVYASAPAFVFFNLLFIW 89 Query: 1079 GVHIAFIRK 1105 GV+I +RK Sbjct: 90 GVYIVILRK 98 >ref|XP_002281137.1| PREDICTED: probable S-acyltransferase At2g14255-like [Vitis vinifera] Length = 311 Score = 59.7 bits (143), Expect = 1e-06 Identities = 33/69 (47%), Positives = 43/69 (62%) Frame = +2 Query: 899 RSFSLLNYFLFLPLKFNVVLNYFAALVLLVFSGVAKFFRRLLRLHASAPAFVFFNTLFIW 1078 R F+ + + LPL +AL+LLV G + RR L ++ASAPAFVFFN LFIW Sbjct: 39 RFFAASSLLIQLPL---------SALLLLVLLGAGRCCRRFLGVYASAPAFVFFNLLFIW 89 Query: 1079 GVHIAFIRK 1105 GV+I +RK Sbjct: 90 GVYIVILRK 98