BLASTX nr result
ID: Coptis23_contig00016059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016059 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517005.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002517005.1| conserved hypothetical protein [Ricinus communis] gi|223543640|gb|EEF45168.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -1 Query: 300 QYEASRVLCEEGWIKKAEFLLKSIQRGPVPSSGSSGCTNIPGVSGPGCP 154 QY+ASR+L ++ K E ++S+QRG PS+G+SGCTNIP GP CP Sbjct: 21 QYQASRILYDQDVNK--ELGVQSLQRGDTPSTGASGCTNIPNTGGPSCP 67