BLASTX nr result
ID: Coptis23_contig00014467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00014467 (469 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA26077.1| conserved hypothetical protein [Albugo laibachii... 61 1e-07 >emb|CCA26077.1| conserved hypothetical protein [Albugo laibachii Nc14] Length = 398 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 5/94 (5%) Frame = -1 Query: 442 LFQDLESKYERWPISQREAAEKQLFQ-LINSPTPIVFDPIVQPHKGRPLGAKRKKAVNSS 266 L+ L ++ P+ Q+ A + + ++ P+ V DP+ K RP GA ++ Sbjct: 303 LYPKLLQVFDTAPVHQQIAIRAHIAEKILKVPSVSVRDPVATNPKERPSGASSRR----K 358 Query: 265 TIRNPSAFEFVERS----RKCSICKVVGHNSRTC 176 +R+PS FE++ERS RKCS+CK GHN RTC Sbjct: 359 QMRHPSTFEYIERSASLTRKCSLCKQFGHNKRTC 392