BLASTX nr result
ID: Coptis23_contig00014437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00014437 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_180244.1| cyclin-B1-4 [Arabidopsis thaliana] gi|75277932|... 62 5e-08 ref|XP_002298451.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002879008.1| CYCB1_4 [Arabidopsis lyrata subsp. lyrata] g... 61 1e-07 ref|XP_003617201.1| Cyclin [Medicago truncatula] gi|355518536|gb... 60 1e-07 ref|XP_002268488.1| PREDICTED: G2/mitotic-specific cyclin-1 [Vit... 60 1e-07 >ref|NP_180244.1| cyclin-B1-4 [Arabidopsis thaliana] gi|75277932|sp|O48790.1|CCB14_ARATH RecName: Full=Cyclin-B1-4; AltName: Full=G2/mitotic-specific cyclin-B1-4; Short=CycB1;4 gi|2760842|gb|AAB95310.1| putative cyclin [Arabidopsis thaliana] gi|15292695|gb|AAK92716.1| putative cyclin [Arabidopsis thaliana] gi|50198987|gb|AAT70494.1| At2g26760 [Arabidopsis thaliana] gi|330252789|gb|AEC07883.1| cyclin-B1-4 [Arabidopsis thaliana] Length = 387 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 164 KHEEIWAPEVNDFVCIVDNAYGRAQILAMEKLIL 63 K+EEIWAPEVNDFVCI DNAY R Q+LAMEK IL Sbjct: 217 KYEEIWAPEVNDFVCISDNAYNRKQVLAMEKSIL 250 >ref|XP_002298451.1| predicted protein [Populus trichocarpa] gi|222845709|gb|EEE83256.1| predicted protein [Populus trichocarpa] Length = 304 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 164 KHEEIWAPEVNDFVCIVDNAYGRAQILAMEKLIL 63 K+EEIWAPEVNDFVCI DNAY R Q+LAMEK IL Sbjct: 138 KYEEIWAPEVNDFVCISDNAYTREQVLAMEKAIL 171 >ref|XP_002879008.1| CYCB1_4 [Arabidopsis lyrata subsp. lyrata] gi|297324847|gb|EFH55267.1| CYCB1_4 [Arabidopsis lyrata subsp. lyrata] Length = 385 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 164 KHEEIWAPEVNDFVCIVDNAYGRAQILAMEKLIL 63 K+E+IWAPEVNDFVCI DNAY R Q+LAMEK IL Sbjct: 215 KYEDIWAPEVNDFVCISDNAYSRKQVLAMEKSIL 248 >ref|XP_003617201.1| Cyclin [Medicago truncatula] gi|355518536|gb|AET00160.1| Cyclin [Medicago truncatula] Length = 421 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 164 KHEEIWAPEVNDFVCIVDNAYGRAQILAMEKLILK 60 K+EEIWAPEVNDFVCI DNAY R Q+L MEK IL+ Sbjct: 252 KYEEIWAPEVNDFVCISDNAYVREQVLVMEKTILR 286 >ref|XP_002268488.1| PREDICTED: G2/mitotic-specific cyclin-1 [Vitis vinifera] gi|296083932|emb|CBI24320.3| unnamed protein product [Vitis vinifera] Length = 460 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 164 KHEEIWAPEVNDFVCIVDNAYGRAQILAMEKLIL 63 K+EEIWAPEVNDFVCI DNAY R QIL MEK IL Sbjct: 292 KYEEIWAPEVNDFVCISDNAYAREQILQMEKSIL 325