BLASTX nr result
ID: Coptis23_contig00014392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00014392 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60905.1| hypothetical protein VITISV_028449 [Vitis vinifera] 56 3e-06 >emb|CAN60905.1| hypothetical protein VITISV_028449 [Vitis vinifera] Length = 1609 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = -1 Query: 147 VYEFDEFGKTALHCAADMRSNQCIELLLRNQARTDLRSTDDSEELPIEM 1 + E DE G+TALH AA+ + +C+ELLLR +ARTDL+S D +L +E+ Sbjct: 649 INEMDENGRTALHTAAEAHAARCVELLLRKRARTDLKSKDGCSQLALEL 697