BLASTX nr result
ID: Coptis23_contig00014390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00014390 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273190.2| PREDICTED: uncharacterized protein LOC100243... 80 1e-13 emb|CAN84127.1| hypothetical protein VITISV_041870 [Vitis vinifera] 80 1e-13 ref|XP_003552266.1| PREDICTED: uncharacterized protein LOC100782... 79 3e-13 ref|XP_003538478.1| PREDICTED: uncharacterized protein LOC100805... 79 3e-13 ref|XP_002528329.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 >ref|XP_002273190.2| PREDICTED: uncharacterized protein LOC100243292 [Vitis vinifera] gi|297736572|emb|CBI25443.3| unnamed protein product [Vitis vinifera] Length = 178 Score = 80.5 bits (197), Expect = 1e-13 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 212 ISNINYGINGAPLRYENKRLFGKKYEAVVYSAGPLAFRPSHC 87 +SN+NYG+ G+PLRYENKRLFGK YEAV+Y+AGPLAFRP+HC Sbjct: 131 LSNVNYGLYGSPLRYENKRLFGKHYEAVIYAAGPLAFRPAHC 172 >emb|CAN84127.1| hypothetical protein VITISV_041870 [Vitis vinifera] Length = 178 Score = 80.5 bits (197), Expect = 1e-13 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 212 ISNINYGINGAPLRYENKRLFGKKYEAVVYSAGPLAFRPSHC 87 +SN+NYG+ G+PLRYENKRLFGK YEAV+Y+AGPLAFRP+HC Sbjct: 131 LSNVNYGLYGSPLRYENKRLFGKHYEAVIYAAGPLAFRPAHC 172 >ref|XP_003552266.1| PREDICTED: uncharacterized protein LOC100782212 [Glycine max] Length = 174 Score = 79.3 bits (194), Expect = 3e-13 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -2 Query: 212 ISNINYGINGAPLRYENKRLFGKKYEAVVYSAGPLAFRPSHC 87 +SN+NYG+NGAPLRYENK+L G KYEAV+Y+AGPLAFRPS C Sbjct: 128 LSNVNYGLNGAPLRYENKKLHGSKYEAVIYAAGPLAFRPSEC 169 >ref|XP_003538478.1| PREDICTED: uncharacterized protein LOC100805413 [Glycine max] Length = 174 Score = 79.3 bits (194), Expect = 3e-13 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -2 Query: 212 ISNINYGINGAPLRYENKRLFGKKYEAVVYSAGPLAFRPSHC 87 +SN+NYG+NGAPLRYENK+L G KYEAV+Y+AGPLAFRPS C Sbjct: 128 LSNVNYGLNGAPLRYENKKLHGSKYEAVIYAAGPLAFRPSEC 169 >ref|XP_002528329.1| conserved hypothetical protein [Ricinus communis] gi|223532284|gb|EEF34087.1| conserved hypothetical protein [Ricinus communis] Length = 174 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -2 Query: 212 ISNINYGINGAPLRYENKRLFGKKYEAVVYSAGPLAFRPSHC 87 +SN+NYGINGAPLRYENK L G YEAVVY+AGPLAFRP+HC Sbjct: 127 LSNVNYGINGAPLRYENKILRGSHYEAVVYAAGPLAFRPAHC 168