BLASTX nr result
ID: Coptis23_contig00011585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00011585 (535 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134132.1| PREDICTED: parafibromin-like [Cucumis sativu... 167 9e-40 ref|XP_002517109.1| conserved hypothetical protein [Ricinus comm... 167 9e-40 emb|CBI26279.3| unnamed protein product [Vitis vinifera] 164 1e-38 ref|XP_002282888.1| PREDICTED: parafibromin-like [Vitis vinifera] 164 1e-38 ref|XP_003610782.1| Parafibromin [Medicago truncatula] gi|217073... 164 1e-38 >ref|XP_004134132.1| PREDICTED: parafibromin-like [Cucumis sativus] gi|449513423|ref|XP_004164322.1| PREDICTED: parafibromin-like [Cucumis sativus] Length = 407 Score = 167 bits (423), Expect = 9e-40 Identities = 79/82 (96%), Positives = 81/82 (98%) Frame = -1 Query: 535 VFVLGKEWQFKDWPFKDHVEIFNKIIGFFMRFEDDSVESAKNVKQWNVKIISISKNKRHQ 356 VFVLGKEWQFKDWPFKDHVEIFNKIIGF+MRFEDDS+ESAKNVKQWNVKIISISKNKRHQ Sbjct: 326 VFVLGKEWQFKDWPFKDHVEIFNKIIGFYMRFEDDSLESAKNVKQWNVKIISISKNKRHQ 385 Query: 355 DRAAALEVWDRLEEFVRSRSRS 290 DRAAALEVWDRLEEFVRSRS S Sbjct: 386 DRAAALEVWDRLEEFVRSRSHS 407 >ref|XP_002517109.1| conserved hypothetical protein [Ricinus communis] gi|223543744|gb|EEF45272.1| conserved hypothetical protein [Ricinus communis] Length = 409 Score = 167 bits (423), Expect = 9e-40 Identities = 80/82 (97%), Positives = 80/82 (97%) Frame = -1 Query: 535 VFVLGKEWQFKDWPFKDHVEIFNKIIGFFMRFEDDSVESAKNVKQWNVKIISISKNKRHQ 356 VFVLGKEWQFKDWPFKDHVEIFNKIIGFFMRFEDDSVESAK VKQWNVKIISISKNKRHQ Sbjct: 328 VFVLGKEWQFKDWPFKDHVEIFNKIIGFFMRFEDDSVESAKTVKQWNVKIISISKNKRHQ 387 Query: 355 DRAAALEVWDRLEEFVRSRSRS 290 DRAAALEVWDRLEEFVRSRS S Sbjct: 388 DRAAALEVWDRLEEFVRSRSHS 409 >emb|CBI26279.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 164 bits (414), Expect = 1e-38 Identities = 78/82 (95%), Positives = 80/82 (97%) Frame = -1 Query: 535 VFVLGKEWQFKDWPFKDHVEIFNKIIGFFMRFEDDSVESAKNVKQWNVKIISISKNKRHQ 356 VFVLGKEWQFKDWPFKDHVEIFNKIIGF+MRFEDDSVESAK VKQWNVKIISISKNKRHQ Sbjct: 231 VFVLGKEWQFKDWPFKDHVEIFNKIIGFYMRFEDDSVESAKIVKQWNVKIISISKNKRHQ 290 Query: 355 DRAAALEVWDRLEEFVRSRSRS 290 DRAAALEVWDRLEEFVRSRS + Sbjct: 291 DRAAALEVWDRLEEFVRSRSHT 312 >ref|XP_002282888.1| PREDICTED: parafibromin-like [Vitis vinifera] Length = 413 Score = 164 bits (414), Expect = 1e-38 Identities = 78/82 (95%), Positives = 80/82 (97%) Frame = -1 Query: 535 VFVLGKEWQFKDWPFKDHVEIFNKIIGFFMRFEDDSVESAKNVKQWNVKIISISKNKRHQ 356 VFVLGKEWQFKDWPFKDHVEIFNKIIGF+MRFEDDSVESAK VKQWNVKIISISKNKRHQ Sbjct: 332 VFVLGKEWQFKDWPFKDHVEIFNKIIGFYMRFEDDSVESAKIVKQWNVKIISISKNKRHQ 391 Query: 355 DRAAALEVWDRLEEFVRSRSRS 290 DRAAALEVWDRLEEFVRSRS + Sbjct: 392 DRAAALEVWDRLEEFVRSRSHT 413 >ref|XP_003610782.1| Parafibromin [Medicago truncatula] gi|217073460|gb|ACJ85089.1| unknown [Medicago truncatula] gi|355512117|gb|AES93740.1| Parafibromin [Medicago truncatula] gi|388521181|gb|AFK48652.1| unknown [Medicago truncatula] Length = 398 Score = 164 bits (414), Expect = 1e-38 Identities = 77/82 (93%), Positives = 79/82 (96%) Frame = -1 Query: 535 VFVLGKEWQFKDWPFKDHVEIFNKIIGFFMRFEDDSVESAKNVKQWNVKIISISKNKRHQ 356 VFVLGK+WQFKDWPFKDHVEIFNKI GFFMRFEDDS+ESAK VKQWNVKIISISKNKRHQ Sbjct: 317 VFVLGKDWQFKDWPFKDHVEIFNKITGFFMRFEDDSIESAKTVKQWNVKIISISKNKRHQ 376 Query: 355 DRAAALEVWDRLEEFVRSRSRS 290 DRAAALEVWDRLEEFVRSRS S Sbjct: 377 DRAAALEVWDRLEEFVRSRSHS 398