BLASTX nr result
ID: Coptis23_contig00010738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00010738 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518453.1| PREDICTED: protein FAM91A1-like [Glycine max] 55 6e-06 >ref|XP_003518453.1| PREDICTED: protein FAM91A1-like [Glycine max] Length = 1009 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 279 SSSARVPGVNLLFDGSQLLQFEIGACLQARQPVFLI 172 S A +PGVNL+FDGS+LL F+IG CLQARQP+ LI Sbjct: 961 SKEAILPGVNLIFDGSRLLPFDIGTCLQARQPISLI 996