BLASTX nr result
ID: Coptis23_contig00000963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00000963 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19139.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002285804.1| PREDICTED: uncharacterized WD repeat-contain... 63 3e-08 ref|NP_565168.4| transducin/WD-40 repeat-containing protein [Ara... 59 4e-07 gb|AAF17690.1|AC009243_17 F28K19.28 [Arabidopsis thaliana] 59 4e-07 ref|XP_002887716.1| At1g78070/F28K19_28 [Arabidopsis lyrata subs... 59 4e-07 >emb|CBI19139.3| unnamed protein product [Vitis vinifera] Length = 591 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +2 Query: 2 FSPDTEALFVAVADRTYGSLLEYNRKRSNQYLYTIV 109 FSPDTEALFV +ADRTYGSLLE+NR+R NQYL +I+ Sbjct: 556 FSPDTEALFVGIADRTYGSLLEFNRRRCNQYLDSII 591 >ref|XP_002285804.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03 [Vitis vinifera] Length = 450 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +2 Query: 2 FSPDTEALFVAVADRTYGSLLEYNRKRSNQYLYTIV 109 FSPDTEALFV +ADRTYGSLLE+NR+R NQYL +I+ Sbjct: 415 FSPDTEALFVGIADRTYGSLLEFNRRRCNQYLDSII 450 >ref|NP_565168.4| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi|13937195|gb|AAK50091.1|AF372951_1 At1g78070/F28K19_28 [Arabidopsis thaliana] gi|25090156|gb|AAN72242.1| At1g78070/F28K19_28 [Arabidopsis thaliana] gi|332197943|gb|AEE36064.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] Length = 449 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 2 FSPDTEALFVAVADRTYGSLLEYNRKRSNQYLYTI 106 FSPDTEALFV VADRTYGSLLE+NRKR++ Y+ +I Sbjct: 414 FSPDTEALFVGVADRTYGSLLEFNRKRNHSYVDSI 448 >gb|AAF17690.1|AC009243_17 F28K19.28 [Arabidopsis thaliana] Length = 523 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 2 FSPDTEALFVAVADRTYGSLLEYNRKRSNQYLYTI 106 FSPDTEALFV VADRTYGSLLE+NRKR++ Y+ +I Sbjct: 488 FSPDTEALFVGVADRTYGSLLEFNRKRNHSYVDSI 522 >ref|XP_002887716.1| At1g78070/F28K19_28 [Arabidopsis lyrata subsp. lyrata] gi|297333557|gb|EFH63975.1| At1g78070/F28K19_28 [Arabidopsis lyrata subsp. lyrata] Length = 449 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 2 FSPDTEALFVAVADRTYGSLLEYNRKRSNQYLYTI 106 FSPDTEALFV VADRTYGSLLE+NRKR++ Y+ +I Sbjct: 414 FSPDTEALFVGVADRTYGSLLEFNRKRNHSYVDSI 448