BLASTX nr result
ID: Coptis23_contig00000769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00000769 (964 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] 57 5e-06 >emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] Length = 115 Score = 57.4 bits (137), Expect = 5e-06 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 22/108 (20%) Frame = +3 Query: 411 AMKIVGFMEDGVNATLPYVKKYGGYAVDKIKQ------------------HPYMSGFIVV 536 A ++ F+ + + L ++ +GGY VD++ + P++ +V+ Sbjct: 3 AESVMKFVVEKLKELLVLLENFGGYLVDEVDKVFAPDSRGEKLRHWIQVGAPFLILGLVL 62 Query: 537 FAFVLWKCRCRCTRG----KMMKAPGRDYMMLRGDFEKDPRSYFLDLR 668 F + C C C RG KMMKAPGRDY M R FE +PR YF LR Sbjct: 63 VVF--YYCCCGCCRGRRGVKMMKAPGRDYRMARPPFESNPRGYFRGLR 108