BLASTX nr result
ID: Coptis23_contig00000721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00000721 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADC84348.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 55 5e-06 gb|ABY57296.1| IPP/DMAPP synthase [Artemisia annua] 55 5e-06 gb|ADM83430.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductas... 55 8e-06 gb|AAD55762.2| chloroplast 1-hydroxy-2-methyl-butenyl 4-diphosph... 55 8e-06 >gb|ADC84348.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Artemisia annua] Length = 455 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 TSGASTPDKAVEDVLMKVFEIKREEALQLV 91 TSGASTPDK VED L+KVFEIKREEALQLV Sbjct: 426 TSGASTPDKVVEDALLKVFEIKREEALQLV 455 >gb|ABY57296.1| IPP/DMAPP synthase [Artemisia annua] Length = 455 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 TSGASTPDKAVEDVLMKVFEIKREEALQLV 91 TSGASTPDK VED L+KVFEIKREEALQLV Sbjct: 426 TSGASTPDKVVEDALLKVFEIKREEALQLV 455 >gb|ADM83430.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductase [Nicotiana benthamiana] Length = 461 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 TSGASTPDKAVEDVLMKVFEIKREEALQL 88 TSGASTPDKAVEDVL+KVF IKREEALQL Sbjct: 432 TSGASTPDKAVEDVLIKVFNIKREEALQL 460 >gb|AAD55762.2| chloroplast 1-hydroxy-2-methyl-butenyl 4-diphosphate reductase [Nicotiana tabacum] Length = 462 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 TSGASTPDKAVEDVLMKVFEIKREEALQL 88 TSGASTPDKAVEDVL+KVF IKREEALQL Sbjct: 433 TSGASTPDKAVEDVLIKVFNIKREEALQL 461