BLASTX nr result
ID: Coptis23_contig00000673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00000673 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306507.1| porin/voltage-dependent anion-selective chan... 58 9e-07 ref|XP_002525270.1| voltage-dependent anion-selective channel, p... 56 3e-06 ref|XP_004148030.1| PREDICTED: mitochondrial outer membrane prot... 55 4e-06 ref|NP_201551.1| voltage dependent anion channel 2 [Arabidopsis ... 55 6e-06 ref|XP_003632501.1| PREDICTED: outer plastidial membrane protein... 55 6e-06 >ref|XP_002306507.1| porin/voltage-dependent anion-selective channel protein [Populus trichocarpa] gi|222855956|gb|EEE93503.1| porin/voltage-dependent anion-selective channel protein [Populus trichocarpa] Length = 276 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = +1 Query: 127 MSKGPGLFTDIGKKGKDLLTK----DQKFSVSTSTDAGV 231 MSKGPGLF DIGKK KDLLT+ DQKFSVST +DAGV Sbjct: 1 MSKGPGLFADIGKKAKDLLTRDYNSDQKFSVSTYSDAGV 39 >ref|XP_002525270.1| voltage-dependent anion-selective channel, putative [Ricinus communis] gi|223535428|gb|EEF37098.1| voltage-dependent anion-selective channel, putative [Ricinus communis] Length = 276 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = +1 Query: 127 MSKGPGLFTDIGKKGKDLLTK----DQKFSVSTSTDAGV 231 MSKGPGLF+DIGKK KDLL K DQKF+VST +DAGV Sbjct: 1 MSKGPGLFSDIGKKAKDLLIKDYSSDQKFAVSTYSDAGV 39 >ref|XP_004148030.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Cucumis sativus] gi|449502740|ref|XP_004161729.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Cucumis sativus] Length = 276 Score = 55.5 bits (132), Expect = 4e-06 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = +1 Query: 127 MSKGPGLFTDIGKKGKDLLTK----DQKFSVSTSTDAGV 231 MSKGPGLF+DIGKK KDLLT+ DQKFSVST + AGV Sbjct: 1 MSKGPGLFSDIGKKAKDLLTRDYISDQKFSVSTYSHAGV 39 >ref|NP_201551.1| voltage dependent anion channel 2 [Arabidopsis thaliana] gi|75171123|sp|Q9FJX3.1|VDAC2_ARATH RecName: Full=Mitochondrial outer membrane protein porin 2; AltName: Full=Voltage-dependent anion-selective channel protein 2; Short=AtVDAC2; Short=VDAC-2 gi|9757871|dbj|BAB08458.1| porin-like protein [Arabidopsis thaliana] gi|21537313|gb|AAM61654.1| porin-like protein [Arabidopsis thaliana] gi|107738407|gb|ABF83692.1| At5g67500 [Arabidopsis thaliana] gi|332010969|gb|AED98352.1| voltage dependent anion channel 2 [Arabidopsis thaliana] Length = 276 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/39 (71%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = +1 Query: 127 MSKGPGLFTDIGKKGKDLLTK----DQKFSVSTSTDAGV 231 MSKGPGLFTDIGKK KDLLT+ DQKFS+ST + +GV Sbjct: 1 MSKGPGLFTDIGKKAKDLLTRDYNSDQKFSISTYSASGV 39 >ref|XP_003632501.1| PREDICTED: outer plastidial membrane protein porin-like [Vitis vinifera] Length = 142 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/39 (71%), Positives = 31/39 (79%), Gaps = 4/39 (10%) Frame = +1 Query: 127 MSKGPGLFTDIGKKGKDLLTK----DQKFSVSTSTDAGV 231 MSKGPGLF DIGKK KDLLT+ DQKF+VST +D GV Sbjct: 1 MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGV 39