BLASTX nr result
ID: Coptis23_contig00000013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00000013 (603 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL10085.1| metallothionein type 2 [Limonium bicolor] 74 3e-11 gb|ABL10086.1| metallothionein type 2 [Limonium bicolor] 71 2e-10 dbj|BAF35950.1| metallothionein [Coptis japonica] 69 8e-10 gb|ABN46987.1| metallothionein-like protein 2a [Nelumbo nucifera] 67 2e-09 dbj|BAD18379.1| type 2 metallothionein [Vigna angularis] 67 2e-09 >gb|ABL10085.1| metallothionein type 2 [Limonium bicolor] Length = 81 Score = 73.6 bits (179), Expect = 3e-11 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 2 APAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 106 AP +S+++GSEMGV AENDGCKCGD CTCNPCTCK Sbjct: 47 APQRSYHDGSEMGVAAENDGCKCGDNCTCNPCTCK 81 >gb|ABL10086.1| metallothionein type 2 [Limonium bicolor] Length = 81 Score = 70.9 bits (172), Expect = 2e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 2 APAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 106 AP +S+++GSEMGV AEN GCKCGD CTCNPCTCK Sbjct: 47 APQRSYHDGSEMGVAAENGGCKCGDNCTCNPCTCK 81 >dbj|BAF35950.1| metallothionein [Coptis japonica] Length = 81 Score = 68.6 bits (166), Expect = 8e-10 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 2 APAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 106 AP K+++EGSEM VGAENDGC+CG CTCNPC CK Sbjct: 47 APEKNYFEGSEMSVGAENDGCQCGANCTCNPCNCK 81 >gb|ABN46987.1| metallothionein-like protein 2a [Nelumbo nucifera] Length = 80 Score = 67.4 bits (163), Expect = 2e-09 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 2 APAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 106 AP K+++EGSEM GAEN+GCKCG CTCNPC CK Sbjct: 46 APQKAYFEGSEMSFGAENEGCKCGSNCTCNPCNCK 80 >dbj|BAD18379.1| type 2 metallothionein [Vigna angularis] Length = 79 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +2 Query: 2 APAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 106 AP K +EG+EMGV ENDGCKCG CTCNPCTCK Sbjct: 45 APVKVQFEGAEMGVAGENDGCKCGSNCTCNPCTCK 79